KEGG   Halomonas sp. KO116: KO116_01916Help
Entry
KO116_01916       CDS       T03800                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
hak  Halomonas sp. KO116
Pathway
hak00550  Peptidoglycan biosynthesis
hak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KO116_01916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hak01002]
    KO116_01916
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hak01011]
    KO116_01916
Enzymes [BR:hak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KO116_01916
Peptidases and inhibitors [BR:hak01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   KO116_01916
Peptidoglycan biosynthesis and degradation proteins [BR:hak01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KO116_01916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AJY50399
UniProt: A0A0D5M1Z6
LinkDB All DBs
Position
2053503..2054717
Genome map
AA seq 404 aa AA seqDB search
MNVFTSIGRSARLCLFAAMATVAVPASAQQVPQPVIPQPQTIIPAAPQLAASSWILMDAN
SGRILAEHNSDERLPPASLTKLMTAYLVERELDRGTINLTDMINISENAWRTGGSKMFIE
VGDQVSVDDLLHGIIIVSGNDASVAMAEHLAGGETPFADLMNQHATRLGMNNTNFQNATG
LPGEQHYSTAHDMARLSQHIINDYPEHYEIYSQRTFSYGGIDQPNRNRLLWRDPSVDGLK
TGWTTEAGFCLVSSAKRDDMRLISVVMGTTSDEARAQETQKLLSYGFRFFETMKLYERGA
VLATPRVWGGDINELRVGVDEEVFMTLPRNRNEELRARLNLNPDLQAPIAIGDEVGTLEV
HLGDEVVGERRLVALENIEEGGLFKRLFDQVQRFFSGLISNFTD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgtttacatccattggccgctctgcacgcctatgcctttttgctgcaatggcg
acggttgctgtgcctgccagtgcacagcaagttcctcaaccggtaattccgcagccgcaa
accattattcctgcggcccctcagttagcggcgagttcgtggatactcatggatgccaac
agtggtcgcattttggcggagcataattcggatgaacgccttccgccggccagtttgacc
aagttgatgacagcctatttggttgagcgtgagcttgatcgaggcactattaatctgact
gacatgattaatattagtgagaacgcgtggcgtaccggcggctctaaaatgtttatcgag
gtgggtgatcaagtttcagtagatgaccttcttcatggaattattattgtgtcgggcaac
gatgccagtgtcgccatggccgagcatttagccggtggagaaacgccctttgcggaccta
atgaatcagcatgccactcggctgggcatgaataatacaaatttccaaaatgccacgggc
ttgccgggcgagcagcactactcaactgcccatgatatggcacgcttatcgcagcacatt
attaatgattatcccgaacattatgaaatttactcccagcgtaccttctcttatggcggc
atcgaccagcccaaccgcaaccgtttgctgtggcgtgacccttcggtcgacggcctaaaa
accggctggaccacagaggctggtttttgcctagtctcgtcggctaagcgtgacgatatg
cgcttgatttccgttgtgatggggaccacctccgatgaggcgcgtgctcaggaaacgcaa
aagctactcagctatggtttccgctttttcgagaccatgaagctttacgagcgtggtgct
gttttggccacgccgcgtgtgtggggtggcgatattaacgaattacgcgtgggggtcgat
gaagaggtctttatgaccttgccgcgtaaccgtaatgaagaactgcgcgcgcgccttaat
ctgaacccggatcttcaggccccgattgctattggtgatgaggtcggcacccttgaggtt
catctgggcgacgaggtggtcggtgagcgtcgcttggtggccttggaaaacattgaagag
ggcggtctcttcaagcgtttgtttgatcaggtgcagcgcttctttagtggcctaatcagc
aactttaccgactaa

DBGET integrated database retrieval system