KEGG   Halomonas sp. KO116: KO116_02787Help
Entry
KO116_02787       CDS       T03800                                 

Definition
(GenBank) Phosphate-transporting ATPase
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
hak  Halomonas sp. KO116
Pathway
hak02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hak00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KO116_02787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hak02000]
    KO116_02787
Enzymes [BR:hak01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     KO116_02787
Transporters [BR:hak02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    KO116_02787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 Mg_chelatase AAA_23 AAA_22 AAA_30 AAA_13
Motif
Other DBs
NCBI-ProteinID: AJY51260
UniProt: A0A0D5M4U7
LinkDB All DBs
Position
2988457..2989188
Genome map
AA seq 243 aa AA seqDB search
MNAHHMPPVATLELDSVGFIHRGHTLLKPTSLRLVGCQRTLIMGPNGAGKSLLMRLAHGL
LTPTSGTVRWQGAQPAQAMVFQRPVLLRRSALDNLTYVLAINKAARPELKALPRKAQAMS
ALEKFGLAHLAKRPARVLSGGEQQRLALARAWLLNPQVLFLDEPTSALDPAAIKAVEDAV
LEFHHSGTRIVMTTHDLHQARRLANDVLFLHNGELLEHTPANDFFTAPSSSEAGAFIRGE
LVW
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacatcatatgccccccgtcgccactctcgagctcgacagcgtgggctttatc
catcgtggccatacgctgcttaagccgacgtcgctgcgcctagtaggctgccagcgtacg
ctaattatgggccctaacggtgcgggcaaaagtctgctcatgcgcttagcccacggcctg
ttaacgcctactagcggcaccgttcgctggcaaggcgcacagcctgcacaagccatggtt
ttccagcgtcccgtgttactgcgtcgctcagcgctggataacctgacctatgtgttagcg
atcaacaaagcggcacgaccagaactgaaagcattacctcgaaaagctcaggcgatgagt
gcccttgaaaagtttggtttagcgcacctcgccaaacggcctgcgcgagtgctttccggc
ggtgagcagcagcgcttagcgctggcgcgagcatggctgctcaatccgcaagtgcttttt
ttagacgaacccacctcggcactcgacccggcggctatcaaagcagttgaagatgcggtt
cttgagttccatcacagcggcacccgtatcgtgatgactacccatgatcttcatcaagcg
cgtcgcttagccaacgacgtgctgtttttgcataacggcgaattactcgaacatacccca
gccaatgatttttttactgccccctcttcatctgaggcaggggcatttattcggggcgag
ctggtttggtaa

DBGET integrated database retrieval system