KEGG   Halobacterium salinarum NRC-1: VNG_0133G
Entry
VNG_0133G         CDS       T00038                                 

Gene name
rpa
Definition
(GenBank) replication A related protein
  KO
K07466  replication factor A1
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
hal03420  Nucleotide excision repair
hal03430  Mismatch repair
hal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_0133G (rpa)
   03420 Nucleotide excision repair
    VNG_0133G (rpa)
   03430 Mismatch repair
    VNG_0133G (rpa)
   03440 Homologous recombination
    VNG_0133G (rpa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hal03000]
    VNG_0133G (rpa)
   03032 DNA replication proteins [BR:hal03032]
    VNG_0133G (rpa)
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_0133G (rpa)
Transcription factors [BR:hal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    VNG_0133G (rpa)
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    VNG_0133G (rpa)
DNA repair and recombination proteins [BR:hal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     VNG_0133G (rpa)
   MMR (mismatch excision repair)
     VNG_0133G (rpa)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     VNG_0133G (rpa)
SSDB
Motif
Pfam: tRNA_anti-codon REPA_OB_2 CDC24_OB3 SSB POT1PC DUF4131 DUF5666
Other DBs
NCBI-ProteinID: AAG18754
UniProt: Q9HSP9
LinkDB
Position
110769..112193
AA seq 474 aa
MGAIEDVYADLDTDVSIEEFREAVESKVEQMGGLADEETAAMLIAHEIDDGEVNGVADID
SEMDEVKFIAKVTRVGDVRTFDREDADDDDAAAEGRVVNVTVADETDDVRVSLWDEQATA
AADDLAPGDVLRIKGRPTDGYNGLEVSADEVELDADEQIDVQIQDEYDAADLSLGVSDVT
LVGEVLDTEAVRTFDRDDGSEGRVSNLVVGDETGRVRVTLWDDQADTATDLDAGAVVEIV
DGYVREREGSLELHVGDTGAVTPVPDADVSFVPDTTSIDSLEQDDTADIAGVVRSVDPTR
TFDRDDGSEGQVRNVRLQDDTGDIRVALWGEKADLDIGPGDEVAALDVEIQDGWQDDIEA
SAGWQASVIPLSDSTQDDAAAGSDGPDRGLAAFGADSDDEPAATDDAADTQTPHSDTPVE
FTGVVVQAQDPLILDDGEETMSVTTDADVTLGQEVTVRGSLDDGRLHADDVTES
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgggcgcgattgaggacgtgtacgctgacctcgacaccgacgtgtctatcgaggagttc
cgggaggccgtcgagtcgaaggtcgaacagatgggggggctcgccgacgaggagacggcg
gcgatgctcatcgcccacgagatcgacgacggcgaggtgaacggcgtcgcggacatcgac
tccgagatggacgaggtgaagttcatcgcgaaagtcacccgcgtgggtgacgtccgcacg
ttcgaccgcgaggacgccgacgacgacgatgcggccgccgaggggcgggtggtgaacgtc
acggtggccgacgaaacggacgacgtccgggtctcgctgtgggacgaacaggccaccgcg
gccgccgacgacctcgcccccggggacgtgctccgcatcaaggggcggccgacggacggc
tacaacggcctggaggtcagcgccgacgaggtcgaactcgacgccgacgagcagatcgac
gtccagatccaggacgaatacgacgccgccgacctctcgttgggggtttcggacgtgacc
ctcgtcggggaggtcctggacaccgaggccgtccggacgttcgaccgtgacgacggcagc
gagggtcgtgtgtcgaatctcgtggtgggcgacgagaccggccgagtgcgagtgaccctg
tgggacgaccaggccgacaccgcgacggatctcgacgccggggccgtcgtcgagatcgtg
gacggatacgtccgcgagcgggagggcagcctcgaactccacgtcggggacaccggcgcg
gtcacgccggtcccggacgccgacgtgtcgttcgttccggacaccacgtccatcgacagc
ctcgaacaggacgacaccgcggacatcgcgggcgtcgttcggtcggtcgaccccacgcgc
acgttcgaccgcgacgacggcagcgagggccaggtacgcaacgtccgcctgcaggacgac
accggcgacattcgggttgcgttgtggggcgagaaggcggatctggacatcggcccgggt
gacgaagtggcggccctcgacgtggagatccaggacggctggcaggacgacatcgaggcg
tcggccggctggcaggcgtcggtgatcccgctgtcggacagcacccaggacgacgccgcc
gccggcagcgacggccccgaccgcgggctggcggcgttcggtgccgacagcgacgacgag
cccgccgccaccgacgacgcggccgacacacagactccacacagcgacacgcccgtggag
ttcaccggcgtcgtcgtgcaggcccaggacccgctgattctggacgacggcgaggagacg
atgagtgtcaccaccgacgccgacgtgactctcggccaggaggtcaccgtccgcggctcg
ctcgacgacggccggctacacgccgacgacgtcacggagtcgtga

KEGG   Halobacterium salinarum NRC-1: VNG_1255C
Entry
VNG_1255C         CDS       T00038                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07466  replication factor A1
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
hal03420  Nucleotide excision repair
hal03430  Mismatch repair
hal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1255C
   03420 Nucleotide excision repair
    VNG_1255C
   03430 Mismatch repair
    VNG_1255C
   03440 Homologous recombination
    VNG_1255C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hal03000]
    VNG_1255C
   03032 DNA replication proteins [BR:hal03032]
    VNG_1255C
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_1255C
Transcription factors [BR:hal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    VNG_1255C
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    VNG_1255C
DNA repair and recombination proteins [BR:hal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     VNG_1255C
   MMR (mismatch excision repair)
     VNG_1255C
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     VNG_1255C
SSDB
Motif
Pfam: tRNA_anti-codon
Other DBs
NCBI-ProteinID: AAG19613
UniProt: Q9HQA2
LinkDB
Position
complement(945880..947262)
AA seq 460 aa
MHTVAVSGPPETGFRSVVCARRWLANPYAPGRPTVRCMNVDDHAEELASDLGVDKAEVKE
NLQNLVEYSVPLEEAKRSLRRKYGDDDGAPSGGPTAVDIADVDTDSGNVTVTATVLTAGK
RSIRYQGDDHVIGEGELADETGRISYTAWEEFGLEPGDTVTIGNASVREWEGSPELNFGE
SATVTSADGDIEMAAEVGGDRDLAALSAGDRGRNVEAVVTEVEERTIDGRDGETEILSGV
LGDETARLPFTDWDPHGEIEAGASVRIEDVYVREFRGVPSVNVSEFSTVERLDHEVEVGG
PTRMAIRDAVARGGAYDVELVGSVIDIRDGSGLIKRCPDCGRVVQTGQCRQHGAVEAEDD
LRVKAVLDDGTDSVTAILDRELTADVYGGTLADAREQAREAMDHSVVADTIAEDVVGREF
RVRGHLSVDEYGANLETIAFAERDDDPAARAAAFLAEVDA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcatacagtcgcggtgtcggggccgcctgaaaccggttttcgttcggtggtatgcgcc
cggcgctggctcgccaacccttatgccccaggacgaccgacagtacgctgtatgaacgtc
gacgatcacgccgaggagctcgcctccgacctcggtgtagacaaagcggaggtcaaagag
aacctgcagaacctcgtggagtacagcgtgccgctggaggaggccaagcgcagcctccgg
cggaagtacggcgacgatgacggggcgccatccggggggccgaccgccgtcgacatcgcg
gacgtcgacacggacagcgggaacgtcactgtcacggcgacggtgctgaccgcggggaag
cgctcgatccgctatcagggcgacgaccacgtcatcggcgagggcgagctggccgacgag
accgggcgcatctcgtacacggcgtgggaggagttcggcctggaacccggcgacaccgtt
actatcgggaacgccagcgtccgcgagtgggagggcagccccgagttgaacttcggggag
tccgcgacggtcacgagcgccgacggcgacattgagatggccgccgaggtgggcggggac
cgcgacctcgcggcgctctcggcgggcgatcgcgggcggaacgtcgaagccgtggtcacg
gaggtcgaggagcgcaccatcgatgggcgggacggcgagacggagatcctctccggcgtg
ctcggcgacgagaccgcgcgcctcccgttcaccgactgggatccccacggcgagatcgaa
gcgggggcgtcggtccgcatcgaggacgtctacgtccgggagttccggggcgtgccgtcg
gtgaacgtgtcggagttctccacggttgagcgcctcgaccacgaggtcgaggtcggcggg
ccgacccggatggcgatccgggacgccgtcgcccgcgggggtgcctacgacgtcgaactc
gtgggcagcgtcatcgacatccgggacggctcggggctgatcaagcggtgtcccgactgt
gggcgggtggtccagacggggcagtgtcgccagcacggcgcggtcgaggccgaagacgac
ctgcgcgtcaaggcggtgctggacgacggcaccgacagcgtcaccgcgatcctggaccgc
gagctgaccgcggacgtctacggcggtacgctggcggacgcccgcgagcaggcccgggaa
gccatggaccactcggtggtcgccgacaccatcgccgaggacgtggtgggccgcgagttc
cgggttcggggccacctctcggttgacgagtacggcgcgaacctcgaaacgatcgcgttc
gcggagcgcgacgacgacccagcggcgcgcgcagcggccttccttgcggaggtggacgca
tga

KEGG   Halobacterium salinarum NRC-1: VNG_2160C
Entry
VNG_2160C         CDS       T00038                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07466  replication factor A1
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
hal03420  Nucleotide excision repair
hal03430  Mismatch repair
hal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2160C
   03420 Nucleotide excision repair
    VNG_2160C
   03430 Mismatch repair
    VNG_2160C
   03440 Homologous recombination
    VNG_2160C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hal03000]
    VNG_2160C
   03032 DNA replication proteins [BR:hal03032]
    VNG_2160C
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_2160C
Transcription factors [BR:hal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    VNG_2160C
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    VNG_2160C
DNA repair and recombination proteins [BR:hal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     VNG_2160C
   MMR (mismatch excision repair)
     VNG_2160C
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     VNG_2160C
SSDB
Motif
Pfam: tRNA_anti-codon Apolipoprotein RMI1_C Notch
Other DBs
NCBI-ProteinID: AAG20297
UniProt: Q9HNC3
LinkDB
Position
1593632..1595053
AA seq 473 aa
MTASSPNRARTSLAAYASAGPVSLPAGSTRTVASGTSSRTRSAYASRVTASRSSAKAARS
AVRRSRLRSSSPSASSCLGRWLRLAGYSRVPVPPASRTAATVCVTARSPGGWSACRRVRR
RGPNACLRGASDRVHPGCGDLKGVGSKHRYVSHRNTRGDGYTTMSDLSDTAQEVHDDLSE
HVDATVDDVEARLEKLVSEYKVPVDEARRSVENHYLDEAGLDRDDLAGGGGNDTVEVEDV
DEAEQWVDITAKVVELWEPRSDSVGQVGLLGDPTGTIKFTKWAKSDLETLDEGQVYRLGN
VVTDEYQGRYSVKLNKTTSIEAVDEEFEVGDNEDEVAGALVDVQSGSGLIKRCPEEDCTR
VLQNGRCNEHGEGDGEFDLRIKGVLDDGTDVHEVIFDEEATEALTGIGLEEAKQMAKDAL
DTTVVADEMRATILGKYYRVTGPTFGRYVLANDTELLTTRPDTESVLIRARSI
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgacggcgtcctcgccgaaccgcgcccgcacctcgctggcggcgtacgcgagcgccggc
cccgtgtccttgcccgccggctccacgaggacggtggcctcggggacctcgtcgcggacg
cggtccgcgtacgcctcgcgggtgaccgccagcaggtcgtcggcgaaggccgcgcggtct
gcggtccggcggagcaggctgcggtcgtcgtcgccgagcgcgagcagctgcttggggcgg
tggctgcggctcgcgggatacagccgggtgccggtgccgccggcgagcaggacggcagcg
acagtgtgtgtcacggcgcgctcacccggagggtggagtgcatgccggcgggttcgacgc
cgcggtccaaatgcctgtctccggggggcgagcgaccgcgttcaccccgggtgcggagat
ttaaagggggttgggagcaaacaccgatacgtctcccatcgaaacacacgcggagacgga
tacacgaccatgagcgacctttcagacacggctcaggaggtccacgacgacctctcggag
cacgtcgacgcgaccgtcgacgacgtggaagcacggctggagaaactggtttctgagtac
aaagtcccggtcgacgaggcccgccgcagcgtcgagaaccactacctcgacgaggccggc
ctcgaccgcgacgacctcgccggcggcggcggcaacgacaccgtcgaagtcgaggacgtc
gacgaggccgagcagtgggtggacatcacggcgaaagtcgtggaactgtgggagccccgt
tcggactccgtcgggcaggtcggcctgctgggcgacccgaccggcacgatcaagttcacg
aagtgggcgaagtcggacctcgaaaccctcgacgaggggcaagtctatcgcctcgggaac
gtcgtcaccgacgagtaccagggccgatactcggtgaagctgaacaagacaacgtccatc
gaggcggtcgacgaggagttcgaggtcggcgacaacgaggacgaggtcgcgggcgcgctc
gtggacgtacagtccggcagcgggctgatcaagcgctgccccgaggaggactgcacgcgc
gtcctccagaacggccgttgcaacgagcacggcgaaggcgacggggagttcgacctccgc
atcaagggggtgctcgacgacggcaccgacgtccacgaggtcatcttcgacgaggaggcc
acggaagccctcactggcatcggcctggaggaggccaagcagatggccaaagacgccctc
gacacgaccgtcgttgccgacgagatgcgcgccacgatcctcgggaagtactatcgggtg
acggggccgacgttcggtcggtacgtgctcgccaacgacaccgagttgcttaccacccgg
ccggacactgaatccgtgctgatccgcgcgaggtcgatctga

DBGET integrated database retrieval system