KEGG   Halobacterium salinarum NRC-1: VNG_0255C
Entry
VNG_0255C         CDS       T00038                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_0255C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_0255C
Enzymes [BR:hal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     VNG_0255C
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    VNG_0255C
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     VNG_0255C
   Elongation factors (archaeal)
     VNG_0255C
SSDB
Motif
Pfam: RVT_3 RNase_H DUF4687
Other DBs
NCBI-ProteinID: AAG18851
UniProt: Q9HSF6
LinkDB
Structure
PDB: 
4NYN 4E19

Position
209439..210038
AA seq 199 aa
MPVVECDIQTARAALADAGASFSDGNSEHELWHADLGDAHAVAYADKLVVQGGSPTDITA
VVQPDRGGRVHAYFDGASRGNPGPAAVGWVLVSGDGGIVAEGGDTIGRATNNQAEYDALI
AALEAAADFGFDDIELRGDSQLVEKQLTGAWDTNDPDLRRKRVRARELLTGFDDWSITHV
PRATNERADALANEALDDA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgccagtcgtcgagtgcgacatccagaccgcccgcgcggcgttggccgacgccggcgca
tcgttcagcgacgggaactccgagcacgaactgtggcacgccgacctcggggacgcccac
gccgtcgcctacgcggacaaactcgtcgtccagggggggtcgcccactgacatcacggcc
gtcgtccaacccgaccgcggcggccgcgtgcacgcctacttcgacggcgcaagccgcggg
aaccccggccccgccgcggtcggctgggtgctcgtctccggcgacggcggcatcgtcgcc
gagggcggcgacaccatcggccgcgccaccaacaaccaggccgaatacgacgccctgatc
gccgccctggaagccgccgccgacttcgggttcgacgacatcgaactccggggggactcc
cagctcgtcgagaaacagctcaccggcgcgtgggacaccaacgaccccgacctcaggcgg
aaacgagtgcgcgcccgcgaactgctcacggggttcgacgactggtcgatcacccacgtg
ccacgggcgaccaacgagcgcgccgacgccctcgccaacgaggccctcgacgatgcctga

DBGET integrated database retrieval system