KEGG   Halobacterium salinarum NRC-1: VNG_0521G
Entry
VNG_0521G         CDS       T00038                                 

Gene name
polB1
Definition
(GenBank) DNA polymerase B1
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_0521G (polB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_0521G (polB1)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VNG_0521G (polB1)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     VNG_0521G (polB1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1
Other DBs
NCBI-ProteinID: AAG19049
UniProt: Q9HRV9
LinkDB
Position
401122..403827
AA seq 901 aa
MGNTELSEFMHESDGADDPGEDAIQEEAAVVAGDADPVVNEVLTAEADALPDATGEVELM
VTQVDYTIEGSGDRERPVLHVFGRTTDDEAEHVRVHGFRPYFYAPTATLSEDDLTDDVIT
GTEDGYESIRGEALTKIFGRTPRDVGNIRDAFDHYEADILFPNRLLIDKDITDGVRVPAR
RADDGALYVHHDEIAACEVAADLRVNTFDIEVNDRNGFPEDGEEPVVCLTSHDSYRDEYV
AWLYAAPDATVDAPTAVPGYDPLTDDADIDVRVFDTEEAMHDAFLSYIEDTNPDVLTGWN
FDDFDAPYLIDRLDELDPRTDHDLDSDRLSRVSEVWTSGWGGPNVKGRVVFDLLYAYQRT
KYSELDSYRLDAVGEQELGVGKERYPGDIGDLWEDDPERLLEYNLRDVELCVEIDRKQSI
VAFWDEARKLVGCKLEDATTPGDAVDMYVLHKAFGNFVLPSKGQQDAEEFEGGAVFDPIT
GVRENVSVLDLKSLYPMSMVTINASPETKVDPEEFDGDTYRTPTGVHFRKEPDGIIREMV
DELLTEREEKKARRDDHEPDSEDYERYDRQQAAVKVIMNSLYGVFGWDRFRLYDRAMSAG
VTSTNREVIDFTEQAAEEFGYEVAYGDTDSVMLELGDDMTKAEAIAESFDIEDHINAAYD
EFAREQLHADDHRFQIEFEKLYRRFFQAGKKKRYAGHIVWKEGKDVDDVDITGFEYQRSD
IAPITKRVQKEVIDLVVREGDVDAVEEYVHGVIEEFQEGDADLDDIGIPGGIGKRLDNYE
TDTAQVRGAKYANLLLGTNFDRGSKPKRLYLAKVHPDFWGHVEDEQGIDTSTSDRYREFR
RDPDVICYEYADQIPDTFVVDYDKMLDKTLKGPIERILEALDLSWDEVKSGQTQTGLGQF
T
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggaaacaccgagctctccgagttcatgcacgagagcgacggggcagacgaccccggg
gaggacgcgatccaggaagaagccgcggtcgtcgccggcgacgccgaccccgtcgtcaac
gaggtgctgacggcggaagcggacgcgctgcccgacgccaccggcgaggtcgaactgatg
gtcacacaggtcgattacacgatcgagggctcgggcgaccgcgagcgccccgtcctccac
gtcttcggccgcacgaccgacgacgaggccgaacacgtccgcgtgcacggctttcggccg
tacttctacgcaccgacggccacgctctccgaagacgacctcaccgacgacgtcatcacc
ggcaccgaggacggctacgaatccatccggggcgaagcgctgacgaagatcttcggccgg
acgccccgcgacgtcgggaacatccgtgacgcgttcgatcactacgaggccgacatcctg
ttcccgaaccgcctgctcatcgacaaggacatcaccgacggcgtcagggtgcccgcccgg
cgcgccgacgacggcgcgctctacgtccaccacgacgaaatcgcggcctgtgaggtcgcc
gccgacctgcgcgtgaacaccttcgacatcgaagtcaacgaccgcaacggcttccccgag
gacggcgaggagcccgtggtctgtctgaccagccacgactcctaccgcgacgaatacgtc
gcgtggctgtacgccgccccggacgcgacggtcgacgcccccacagcggtcccgggctac
gacccactgaccgacgacgccgacatcgacgtgcgcgtgttcgacaccgaggaagccatg
cacgacgcgttcctctcgtacatcgaggacaccaaccccgacgtgctcacgggctggaac
ttcgacgacttcgacgccccctacctcatcgaccggctggacgaactcgacccacgaacc
gaccacgacctcgactccgaccgcctctcccgcgtcagcgaagtctggacgtccggctgg
ggcggcccgaacgtgaaaggacgggtggtcttcgacctgctgtacgcctaccagcgcacg
aaatactcggagctggactcctaccggctggacgccgtcggcgaacaggagctgggcgtc
ggcaaagagcgctaccccggggatatcggcgacctctgggaggacgaccccgagcgcctc
ctggagtacaacctccgggacgtcgagctctgcgtggaaatcgaccgcaagcagtccatc
gtggcgttctgggacgaagcccgcaagctcgtgggctgcaagctggaggacgccacgacc
cccggggacgcggtggacatgtacgtcctgcacaaggcgttcgggaacttcgtgttgccg
tcgaaaggccaacaggacgccgaggagttcgagggcggcgcggtcttcgaccccatcact
ggcgttcgggagaacgtctccgtgctggacctgaagagcctctacccgatgtcgatggtg
accatcaacgccagcccggagaccaaagtcgaccccgaggagttcgacggcgacacctac
cggacgccgacgggcgtccacttccggaaggaacccgacggcatcatccgggagatggtc
gatgaactcctcaccgagcgcgaggagaagaaagcacgccgcgacgaccacgagccggac
agcgaggactacgagcgctacgaccgccagcaggccgccgtgaaggtcatcatgaacagc
ctctacggcgtgttcggctgggaccgcttccggctctacgaccgcgcgatgagcgcgggc
gttacctccacgaaccgcgaggtcatcgacttcaccgagcaggccgccgaggagttcggc
tacgaggtcgcgtacggcgacaccgacagcgtcatgctcgaactcggcgacgacatgacg
aaagcggaggccatcgcggagtcgttcgacatcgaggaccacatcaacgccgcctacgac
gagttcgcccgcgagcaactgcacgccgacgaccaccgcttccagatcgagttcgagaag
ctctaccggcggttcttccaggccggcaagaagaagcgctacgccggccacatcgtctgg
aaggagggcaaggacgtcgacgacgtcgacatcacgggcttcgagtaccagcgctcggac
atcgcgccgatcacgaagcgcgtccagaaggaggtcatcgacctcgtggtgcgggagggc
gacgtggacgccgtcgaggagtacgtccacggcgtcatcgaggagttccaggagggggat
gcggatctggacgacatcggcatcccgggcggcatcggcaaacgactggacaactacgag
acggacaccgcccaggtgcgtggtgcgaagtacgccaacctgctgttgggcacgaacttc
gaccgcgggtccaagcccaagcggctctacctcgcgaaagtgcatccggacttctggggt
cacgtcgaagacgaacagggcatcgacacgagcacgagcgaccgctaccgcgagttccgc
cgggatcccgacgtgatctgttacgagtacgccgaccagatcccggacacgttcgtcgtc
gactacgacaagatgctcgataagacgctcaaaggccccatcgagcgcatcctcgaggcg
cttgatctctcctgggacgaggtgaaatccggccaaacgcagaccgggctgggccagttc
acgtag

KEGG   Halobacterium salinarum NRC-1: VNG_6362G
Entry
VNG_6362G         CDS       T00038                                 

Gene name
polB2
Definition
(GenBank) DNA polymerase B2
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_6362G (polB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_6362G (polB2)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VNG_6362G (polB2)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     VNG_6362G (polB2)
SSDB
Motif
Pfam: DNA_pol_B
Other DBs
NCBI-ProteinID: AAG20982
UniProt: Q9HHJ8
LinkDB
Position
pNRC200:289084..291252
AA seq 722 aa
MPFSIDFLDDGRVLEWEATADGAVATERDNYTPRFYVAARDPDADLDLTTLQSVYDQHPD
VVATEMVARRPGFRRDEEAVLAVDVAHIDRVTPLARQARQLSAYPVGDLACFNVDFSREF
RYCLETGADPTPASELSTLRLSVPVTETSNDIYEELSVAGDAVTGSSTDILAAVQGALEA
HDPDVLVCSTSEIVPTLHEMATDAGVDDFSLSRWPDVDYQQLASRSTYSSYGRVGHSPAR
YNVPGRAIIDESNTFFYGETNLDGVLDLVSRSKNPVQELAWASIGNVLTAIQICEANDRG
VLVPWNSWRHEFYKPMGTLHDADRGGFIFAPEVGLHENVHELDFSSLYPNIICTRNVSPD
VIRCDCHSDRDDVPGLGYSICDDRGYLVDVLQPIIDARDEIKAAIRRETDRDDPDEDRLA
ELEGRSGALKWILVACFGYQGFSNAKFGRIECHEAINAFAREILLMAKQRLEAGGWRVVH
GIVDSIWVTPDPDVDEEDREDLQTLATEITERVEIRLEHEAHYDWVAFVPQRESDAGALT
KYFGKVAGDDDFKVRGIEARQRSTPPFIEDVQRDCLDRLDATRSPDAVLGRLERAIDELQ
AGNVAVERLVERNRVSKPLEGYSQNTQNVAALKRAREQDLAVHPGQDIEYVVVDDEKSSR
DRVALAHEAIETYDTSYYETQLVRAVESVLSPLGWDRSNIHRELSGERDAVLTSFGASNE
LS
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgccgttcagtatcgatttcctggacgacggccgcgtcctggagtgggaggcgaccgct
gacggtgccgtcgcaacagaacgggataactacacaccgcgattctacgtcgccgctcgc
gaccctgatgccgacctcgacctcacgacactccagtcggtgtacgaccagcacccggat
gtcgtcgcgaccgagatggttgcgcgacgccccggctttcgacgagacgaggaggccgtt
ctcgcagtcgacgttgcccacatcgatcgcgtcactccactcgcccggcaggcgcgtcag
ctgtcggcctatccagtcggggatctcgcctgtttcaacgtggacttttcgcgagagttc
cgatactgtctagagaccggcgccgatccgacgccagcgagcgagctgtcgacgctccgg
ctcagtgtcccggtgaccgaaacgagcaacgacatctacgaggaactgtccgtcgccggc
gacgccgtcaccggctcgtcgacggatatcctggccgccgtccagggggcgctcgaagca
cacgatccggacgtcttggtctgctcgacgagcgagatcgtcccgacccttcacgagatg
gcgacggacgccggcgtcgacgacttctcgctgagtcggtggccggacgtcgactaccag
cagctcgcgagccggtcgacgtactcgagctacggccgcgtcggccactcgccggcgcgg
tacaacgtgcccggccgggcgattatcgacgagtcgaacacgttcttctacggggagacg
aacctcgacggcgtcctcgacctcgtgtcgcgctcgaaaaatcccgttcaggagctcgcg
tgggcatcgatcgggaacgttctcacggcaatccagatctgcgaggccaacgaccgcggc
gtcctcgtcccatggaactcctggcgccacgagttctacaagccgatggggacactccac
gacgccgaccgcggcgggttcatcttcgcccccgaggtcggcctccacgagaacgttcac
gaactcgacttctcctcgttgtatccgaacatcatctgtacccggaacgtctcgccggac
gtcatccggtgtgactgccacagcgaccgcgacgacgtccccggtctcggatactcgatc
tgcgacgaccggggctacctcgttgacgtgctacagccgatcatcgacgcgcgcgacgag
atcaaggcggccatccgtcgcgagacggatcgagacgaccccgatgaggaccgactggca
gaactcgagggacggtcgggagcgctgaagtggatcctcgtcgcctgcttcggctatcaa
gggttcagcaacgcgaagttcggccgcatcgagtgccacgaagcgatcaacgcgttcgct
cgcgagattctgctgatggcgaaacagcgactggaagccggcggctggcgggtcgtccac
ggcatcgtcgactccatctgggtgaccccggaccctgacgtcgacgaggaggaccgcgaa
gacctccagacgctcgcgacggagatcacggaacgtgtcgagattcggctcgaacacgag
gcgcactacgactgggtggcgttcgtgccgcagcgcgagagcgacgccggcgcgctgacg
aagtacttcgggaaggtcgccggcgacgacgacttcaaggtcagaggtatcgaagcccgg
cagcgctcgaccccgccgttcattgaggacgtccagcgggactgtcttgaccggctcgat
gccacgcggtcaccggacgcggtgcttggacggctcgaacgagcaatcgacgaactgcag
gcgggcaacgtggcagtggagcggctcgtcgaacggaaccgtgtctcgaagcccctggag
ggctactcacagaatacccagaacgtggccgccttgaagcgagcccgcgagcaggaccta
gcagtccacccaggccaggatatcgagtacgtggtcgtcgacgacgagaaatcctcacga
gaccgggtcgccctcgcccacgaagcgatcgagacctacgacacctcgtactacgaaacg
cagctggtcagagcggtcgagagcgtgctttcaccgctcgggtgggatcggtccaacatt
catcgagagctctccggtgagagggacgccgttttgacctcgttcggagcctccaacgaa
ctgtcgtag

DBGET integrated database retrieval system