KEGG   Halobacterium salinarum NRC-1: VNG_1359G
Entry
VNG_1359G         CDS       T00038                                 

Gene name
rad2
Definition
(GenBank) DNA repair protein
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
hal03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1359G (rad2)
   03410 Base excision repair
    VNG_1359G (rad2)
   03450 Non-homologous end-joining
    VNG_1359G (rad2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_1359G (rad2)
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_1359G (rad2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hal04147]
    VNG_1359G (rad2)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     VNG_1359G (rad2)
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    VNG_1359G (rad2)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     VNG_1359G (rad2)
DNA repair and recombination proteins [BR:hal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VNG_1359G (rad2)
Exosome [BR:hal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VNG_1359G (rad2)
SSDB
Motif
Pfam: XPG_I XPG_N 5_3_exonuc GreA_GreB_N
Other DBs
NCBI-ProteinID: AAG19690
UniProt: Q9HQ27
LinkDB
Position
complement(1013308..1014291)
AA seq 327 aa
MGNADLRQLAAIEETPFADLEGSVVAVDAHNWLYKYLTTTVQWTGADVYTTSDGTEVANL
VGAVQGLPKFFEHGLTPVFVWDGGVTELKDDEIADRREQRERYEEQLDDAREAGDAAEAA
RLDARTQRLTPTIHETTRELFDLLDIPQVEAPAEGEAQAAYMTRTDDAVDYAGSDDYDCL
LLGSPVTLRQLTSSGHPELMDFDATLAEHDLTWEQLVDVGILCGTDFNPGIDGFGPTTAL
DAIGEHGDLWDVLAAEGEHVAHGDRIRELFLNPDVTDDYVIDPDVSPAIDAARAFVTDEW
EVDADAVARGFERIDAAAAQTGLDRWT
NT seq 984 nt   +upstreamnt  +downstreamnt
atggggaacgcggacctccggcagctcgcggccatcgaggagactcccttcgcggacctc
gaagggagtgtggtggccgtcgacgcccacaactggctgtacaagtacctcaccacgacc
gtccagtggaccggcgcggacgtctacaccaccagcgacggcaccgaagtggcgaacctc
gtcggcgcggtgcagggcctgccgaagttcttcgaacacggcctcacgcccgtgttcgtc
tgggacggcggggtcaccgagctcaaagacgacgagatcgccgaccgccgcgagcaacgc
gagcgctacgaggaacagctcgacgacgcccgcgaggcgggcgacgccgccgaggcggcg
cgcctggacgcgcgcacgcagcgactcacgcccaccatccacgagaccacccgggagctg
ttcgacctgttggacatcccgcaagtcgaagcccccgcggagggcgaagcacaggccgca
tacatgacgcggacggacgacgccgtcgactacgcgggcagcgacgactacgactgcctg
ctgcttgggtcgccggtgacgctgcgccagctcacgagctccggccacccggagctgatg
gacttcgacgcgacgctcgccgaacacgacctgacgtgggagcaactcgtcgacgtcgga
atcctctgtgggacggatttcaaccccgggatcgacgggttcggaccgacaacggccctg
gacgcgatcggcgagcacggcgacctctgggacgtgctggcggccgaaggcgagcacgtc
gcccacggcgaccgcatccgggagctgttcttgaaccccgacgtgaccgacgactacgtg
atcgaccccgacgtgtcgccggccatcgacgcggcccgcgcgttcgtcaccgacgagtgg
gaggtcgacgccgacgcggtcgcccgggggttcgagcgcatcgacgccgcggccgcacag
accggcctcgaccggtggacgtga

DBGET integrated database retrieval system