KEGG   Halobacterium salinarum NRC-1: VNG_1470G
Entry
VNG_1470G         CDS       T00038                                 

Gene name
pri
Definition
(GenBank) DNA primase
  KO
K02683  DNA primase small subunit [EC:2.7.7.102]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1470G (pri)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_1470G (pri)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.102  DNA primase AEP
     VNG_1470G (pri)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    VNG_1470G (pri)
SSDB
Motif
Pfam: DNA_primase_S
Other DBs
NCBI-ProteinID: AAG19774
UniProt: Q9HPU3
LinkDB
Position
1090362..1091636
AA seq 424 aa
MHRAPGRFVRPRRAVDPGETTLIYPRSAYCRPDMEERTRAYLRGRFGDVYRRAEIDLPPR
ADDREWGYIPWTAGPDTTMVRHKSTLDLGSMTSFLERKCPRHVYFSAGTYDAPGAATMDE
KHWQGSDLVFDLDADHLPRVTLGEDSYAEMLSKCKDALLRLLDFLERDFGFEELTVTFSG
GRGYHVHVRDAGVYELGSEERREIVDYVRGNDLALETLVEAEPVGGRGLENPTEKRMLPA
DGGWGRRVTTRLEAFADDLIERGEDDAVATLTEFDGVGERSARAIYNVVADNTTAVKRGN
VDVHPAFLTVARRYIDETVAAEQAPIDEPVTTDTNRLIRLPGSLHGGSGLEVQRLDRAAL
DDFDPLVDAVPETFVGHDITVELPTEHTVELRGESLTVGPGVSTVPEYAGVFMMARGTAE
KATE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcaccgggcgccgggtcggttcgtccggccgagacgcgctgtcgatcccggcgagacg
acactgatttacccgcggtcggcgtactgccgtcccgacatggaggaacggacccgtgcg
tatctccgggggcggttcggcgacgtgtaccgccgtgcggagatcgacctccccccgcgc
gccgacgaccgcgagtgggggtatatcccgtggactgccggccccgacacgacgatggtt
cggcacaaatccacgctggatctggggtcgatgacgtcgttcctcgaacggaaatgcccc
cggcacgtctatttctcggcgggcacctacgacgctccgggggcggcgacgatggacgaa
aaacactggcagggctcggatctggtgttcgacctcgacgccgaccacctgccgcgtgtc
accctcggggaggattcctacgcggagatgctgtcgaagtgcaaggacgcactgctgcgg
ctgctcgatttcctcgagcgcgatttcgggttcgaggagctgaccgtgacgttctccggc
ggccgcggataccacgtgcacgtccgcgatgcgggcgtctacgagctcggcagcgaggag
cgccgggagatcgtcgattacgtgcgcggcaacgacctggcgttggagacgctggtcgag
gccgaacccgtcggcgggcgcgggctagagaaccccaccgagaagcggatgctgccggcc
gacggcggctggggccgtcgggtcaccacccgcctcgaagcgttcgccgacgacctcatc
gagcgcggcgaggacgacgccgtggcgacgctcacggagttcgacggcgtcggagagaga
tcggcgcgggccatctacaacgtggtcgcggacaacaccacggcggtgaagcgtggaaac
gtcgacgtgcatccggcgttcctgacggtcgcgcggcgctacatcgacgagaccgtcgcg
gccgagcaggcacccatcgacgagccggtgaccaccgacacgaaccgcttgatccggctg
cccggatcgctgcacggcggcagcgggctggaggtgcagcgcctcgaccgtgccgcactc
gatgacttcgatccgctcgtcgacgccgttccggagacgttcgtcggccacgacatcacc
gtcgagctacccacagagcacaccgtcgagctgcgtggggaaagccttacagtcgggccg
ggcgtgagcacagttccagagtacgcgggtgtcttcatgatggcccgcggtaccgccgag
aaggccacagaatga

DBGET integrated database retrieval system