KEGG   Halobacterium salinarum NRC-1: VNG_1501G
Entry
VNG_1501G         CDS       T00038                                 

Gene name
hel
Definition
(GenBank) DNA helicase
  KO
K10742  DNA replication ATP-dependent helicase Dna2 [EC:3.6.4.12]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1501G (hel)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_1501G (hel)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VNG_1501G (hel)
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    VNG_1501G (hel)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     VNG_1501G (hel)
SSDB
Motif
Pfam: AAA_11 AAA_12 AAA_30 AAA_19 PDDEXK_1 Dna2 Viral_helicase1 Cas_Cas4 UvrD-helicase AAA_22 ResIII AAA_16 PhoH DUF2075 UvrD_C_2 Helicase_RecD PIF1 AAA AAA_25 SRP54 CbiA TrwB_AAD_bind bpMoxR AAA_24 PDZ_6 DUF853 MeaB IstB_IS21 AAA_7 RuvB_N AAA_10
Other DBs
NCBI-ProteinID: AAG19799
UniProt: Q9HPR8
LinkDB
Position
1113845..1116310
AA seq 821 aa
MELAVHDATEDGAGYATAASSWVVVEPEFVVDVTDIRSFVQCPRLYYLNKLSGLPLKYPV
TKGTIVHEVFGDLLRGRDLEASVAQRVDEAGLELGLLGRSRAEVEADVRDNASAIEGWLQ
QGRLTDEDEWRSEYTLVSERFGIKGRCDAIRRGMPVELKTGKNTNREPRFHDKVQAACYA
LMLDEHGVPADTGTLLYTKNAAVDRSEASGDLSPAKEFSIGRGFLEFVVRERNHLAALEA
SDGPPTGYEADAKCDYCFEQDTCMVVSGRLDQESKAGRIGDPVPAEERAYFDELYDAIEA
ERGAIHDEYRKLWEQSPDERAADDRAVVGLSPAEQTELPDGRWRLTATRPGSAASKIREG
DRVLASDGDPVAGRAEMARVERLDADRVEVTTDEPVSLCRLDVYPSELSVDRMLTALHDA
VLKSDQRRTDLLFDRASPRFEGGDHDLIPNNDAQNAAVNRALNAEDFALVHGPPGTGKTY
TIATLVQAFVARGDRVLVSAFTNRAVDNALDALRQQGHEDIVRVGTETGVRADMQDLRLD
RSGDPGERAAALRSAPVVAATTATCGSRILRELEFDVVLVDEASQLTEPDTLAAINRGAR
FVLVGDHEQLPPVVRSGGRLSKSLFERLHETYPEASVMLDQQYRMSQRIQAFSSREFYDG
QLRPASSEVAGQRLTDVGVDPGGAVHGGVTFYDVPGTDDAHVDPAEADRVADVVTAYVDA
GLDPGEIGVIAPFRAQVAEIGRRTPAGVAVDTVDRFQGSSKEVIVVSFVARGTLEGPIFE
DHRRVNVALSRAKKSLVLVGDERALRSEPLYDRMIDWADME
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggagcttgcggtgcacgacgccaccgaggacggggcggggtacgcaaccgcggcgtcg
tcgtgggtggtcgtcgaaccggagttcgtcgtggacgtgaccgacatccggtcgttcgtg
cagtgcccgcggctctactacttgaacaagctctccgggctgccgttgaagtatccggtg
acgaaaggaacgatcgtccacgaggtgttcggggatctgcttcggggccgcgatctggag
gcgtcggtcgcccaacgggtcgacgaagccggcctggaactcgggctgctgggtcggagc
cgcgcggaagtcgaggccgacgtgcgggacaacgccagcgccatcgagggctggctccag
cagggccggctgaccgacgaggacgagtggcgctcggagtacacgctggtttccgagcgc
ttcggcatcaaaggccggtgtgacgccatccggcgcgggatgcccgtggagctgaaaacg
gggaagaacacgaaccgcgagccccgattccacgacaaagtgcaggcggcctgttacgcg
ctgatgttggacgagcacggcgtccccgcggacacggggacgctgctgtacacgaagaac
gcggccgtcgaccgcagcgaggcgtccggcgacctctcgcccgccaaggagttctccatc
ggccgggggttcctggagttcgtcgtgcgggagcgcaaccacctcgccgccctcgaagcg
agcgacggcccgccgacgggctacgaggccgacgccaaatgcgactactgcttcgagcag
gacacctgcatggtggtctcgggccgcctcgatcaggagtccaaggccggccggatcggc
gatccggtgcccgccgaggagcgcgcgtacttcgacgagctgtacgacgccatcgaggcc
gagcgcggcgcgatccacgacgaataccgcaagctctgggagcagtcccccgacgagcgc
gcggcggacgaccgcgccgtcgtcggcctcagcccggccgagcagacggagcttccggac
ggccgctggcggctgaccgccacccgccccggcagcgccgcctcgaagatccgggagggc
gaccgcgtgctcgcctcggacggcgaccccgtggcggggcgcgcggagatggcgcgcgtc
gagcgattggacgccgaccgcgtcgaggtcaccaccgacgaacccgtctcgctctgccgg
ctagacgtctacccctcggagctctccgtcgaccggatgctgaccgcgctccacgacgcc
gtgctgaaaagcgaccagcgccgcacggacctcttattcgaccgggccagcccccgtttc
gaaggcggagaccacgacctgatcccgaacaacgacgcccagaacgcggccgtgaaccgc
gcgctgaacgccgaggacttcgcgctcgtccacgggccgcccggcacggggaagacgtac
accatcgccaccctggtgcaggcgttcgtggcgcgcggcgaccgcgtgctcgtctcggcg
ttcacgaaccgcgcggtggacaacgccctcgacgcgctccgccagcagggccacgaggac
atcgtgcgggtcggcacggaaaccggcgttcgggcggacatgcaggacctccggctggat
cggtccggtgaccccggcgagcgcgcggccgccctgcggtcggcgcccgtcgtcgccgcc
accacggccacgtgtggctcccgcatcctccgggagttggagttcgacgtggtgctcgtc
gacgaggccagccagctcaccgagccggacacgctggccgcgatcaaccggggcgcgcgg
ttcgtgctcgtcggcgaccacgagcagctcccgccggtggtgcgttccggcggccggctc
tcgaaatccctcttcgaacgcctccacgagacgtacccggaggcgtcggtgatgctcgac
cagcagtaccggatgagccagcgcattcaggcgttctccagccgcgagttctacgacggc
cagctgcggccggcatcgagcgaggttgctggccagcggctcaccgatgttggggtcgac
cccggtggtgccgtccacggcggggtcacgttctacgacgtgcccggcacggacgacgcc
cacgtcgaccccgcggaagccgatcgtgtcgcagacgtcgtcaccgcgtacgtcgacgcc
gggctggatcccggtgagatcggcgtcatcgcgccgttccgcgcacaagtcgcggagatc
gggcggcgcaccccggcgggcgtcgccgtcgacaccgtcgaccgcttccagggctcctcg
aaggaggtcatcgtcgtctcgttcgtcgcccgcggcacgcttgagggccccatcttcgag
gaccaccggcgggtgaacgtcgcgctctcccgcgcgaaaaagagcctcgtgctcgtcggc
gacgagcgggcgctgcgctcggagccgctgtacgaccgcatgatcgactgggcggacatg
gagtga

DBGET integrated database retrieval system