KEGG   Halobacterium salinarum NRC-1: VNG_1622G
Entry
VNG_1622G         CDS       T00038                                 

Gene name
rfcB
Definition
(GenBank) replication factor C large subunit
  KO
K04800  replication factor C large subunit
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1622G (rfcB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_1622G (rfcB)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     VNG_1622G (rfcB)
SSDB
Motif
Pfam: AAA AAA_22 AAA_16 RuvB_N AAA_assoc_2 AA_kinase AAA_33 AAA_28 AAA_14 Viral_helicase1 Hydin_ADK IstB_IS21 Zeta_toxin IPT RNA_helicase NACHT Rad17
Other DBs
NCBI-ProteinID: AAG19883
UniProt: Q9HPI4
LinkDB
Position
1207038..1208543
AA seq 501 aa
MPCVATERWGKTVVAGAPQHLTRTPAYGVSMVDWTEKYRPASLSEVRGNDTARDALAEWA
ETWPDHREAVVVHGSPGIGKTSAAHALANDAGWDVVELNASDQRTADVVERVAGEAARSG
TLTGGSGGRKLVLLDEADNLHGNIDRGGSAAITRLVDDAPQPIVLVANEYYEMSSSLRSA
CREIEFRDVSKRSIVPVLRDVCRREDVTYEEDALAAIAEQNAGDLRSAVNDLQALAEQDR
TLTADDVVMGERDRTEGVFDYLDDVIATHSAREALQAAYDVDETPDDLLSWVADNVPKDY
RGGELADAYEFLSNADVWLGRVRATQNYAYWRYATDNVAAGVAAARRHDHGGWTRYGPPS
YWRKLGSSRATREKRDYVARHIAETAGCSMATARNDVLPFLRVLTHHCKNRELTVAMAAA
YELDTEHVAFVTGSGETTNKVASIVADAEERRTDAAVDHSEGAFAGAVREDNTDEDSAAD
ETTDGDEDTGADSQRGLDEFF
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgccatgcgtagctaccgagcggtggggcaaaactgtagtggccggtgctccgcaacac
ctaacccgaactcccgcgtacggagtgtcaatggtagattggacggagaagtaccgtccg
gcgtcgctgtcggaggtgcggggaaacgacacggcccgggacgcgctggcggagtgggcg
gagacgtggcccgaccaccgcgaggcggtggtggttcacggcagccccggcatcgggaag
acgtcggcggcccacgcgctcgcgaacgacgccggctgggacgtcgtggagttgaacgcc
agcgaccagcgcacggccgacgtggtcgagcgcgtcgccggggaggccgccagatcgggc
acgctcaccggcggctcgggcggccggaagctcgtgttgttggacgaggcggacaacctc
cacgggaacatcgaccgcggcggcagcgcggcgatcacgcggctggtcgatgacgcccca
cagcccatcgtcctggtggccaacgaatactacgagatgagttcgtcgctgcgcagcgcc
tgccgggagatcgagttccgggacgtctcgaagcggtcgatcgtgcccgtgttgcgcgac
gtctgccgccgggaggacgtgacctacgaggaggacgcgctggcggcgatcgctgagcag
aacgcgggcgacctgcggtcggcggtcaacgacctgcaggcgctcgccgagcaggaccgc
acgctcaccgccgacgacgtggtgatgggcgaacgcgaccgcaccgagggggtcttcgat
tacctggacgacgtcatcgcgacgcacagcgcccgggaggcgctgcaggcggcctacgat
gtcgacgagacgcccgacgatctcctgagctgggtggcggacaacgtgcccaaggattac
cgcggcggcgagctcgcggacgcctacgagttcctctcgaacgccgacgtctggctgggg
cgcgtgcgggcgacccagaactacgcgtactggcgctacgccacggacaacgtggccgcc
ggcgtggcggcggcgcgccgccacgaccacggcggctggacgcggtacgggccgccgagc
tactggcggaagctcgggagttcgcgggcgacccgggagaagcgtgattacgtcgcgcgc
cacatcgcggagaccgccggctgcagcatggcgaccgcgcgcaacgacgtcctcccgttt
ctcagggtgctcacccaccactgcaagaaccgcgagctgacggtggcgatggcggccgcc
tacgaactggacaccgagcacgtggcgttcgtcacgggctccggggagacgacgaacaag
gtggcgtcgatcgtggcggacgccgaggagcgccggacggacgcggcggtcgaccactcg
gagggggcgttcgcgggcgcggtccgcgaggacaacaccgacgaggacagcgccgccgac
gaaactactgacggcgacgaagacaccggagccgacagccagcgcggtctcgacgagttc
ttctag

DBGET integrated database retrieval system