KEGG   Halobacterium salinarum NRC-1: VNG_1784C
Entry
VNG_1784C         CDS       T00038                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1784C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_1784C
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     VNG_1784C
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    VNG_1784C
SSDB
Motif
Pfam: Toprim_4 Toprim_2
Other DBs
NCBI-ProteinID: AAG20005
UniProt: Q9HP65
LinkDB
Position
complement(1320001..1321353)
AA seq 450 aa
MESWYASHPGLIIGFRGWLPGRRFHAAHDRYLTTPVIQQCNTKPMEDTAKYLIHADFVVD
GVVERSDVVGAAFGQTEGLLGDDLAIPDLQDSAKLGRIDVSVDSEGGQSFGDITIASSLD
RVETATLAAALEAVERIGPCRADVEVDRIEDVRAAKRREVVDRAKELLATAFDEGAINAD
DILDEVRESVRVDDITDYDGYPAGPNVDSSDAVVIVEGRADVVTLLKYGIKNAVAVEGTN
IPDAIAALSREKTATAFLDGDRGGDMILRELGQVGSLDFVARAPMGECVEDLSRRTVDSA
LRNKTPASAAAPIATTQSETAATDGSATPAPTPEPAPDTAPSPDSDGDDTEAAAPPTLAE
HARAVADTETARLLDDALARIREVPAAEVVDAVADADSVPAVVVVDATITQRLLDVAAQR
GVASLIGADTDEFVKQPLATRVRTLDDART
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggaatcatggtacgcgtcccatcccgggttaatcattgggttccgggggtggctgcca
ggacgccggtttcatgccgctcacgacaggtatttgacgacccccgtcatacaacaatgc
aacacgaaaccgatggaagacaccgccaaatacctcattcacgcggacttcgtcgttgac
ggcgtcgtcgagcgcagcgacgtcgtcggtgccgcgttcgggcagaccgaggggctgctc
ggcgacgacctcgcgatccccgacctccaggactccgcgaagctcggccgcatcgacgtc
tccgtggacagcgagggcggccagtcgtttggcgacatcaccatcgcatccagtctcgac
cgcgtcgaaaccgcgacgcttgcggcggccctcgaagccgtcgaacgcatcgggccgtgt
cgcgccgacgtcgaagtcgaccgcatcgaggacgtgcgcgccgccaagcgccgcgaagtc
gtcgaccgcgcgaaagaactgctcgcgaccgccttcgacgagggcgcgatcaacgccgac
gacatcctcgacgaggtccgggagagcgttcgcgtcgacgacatcaccgactacgacggc
tatccggccggcccgaacgtcgactccagcgacgccgtcgtgatcgtggagggccgcgcc
gacgtcgtcaccctcctgaaatacggcatcaagaacgccgtcgccgtcgaaggcaccaac
atccccgacgccatcgcggcgctctcccgggagaagaccgcgacggcgtttctcgacggc
gaccgtggcggcgacatgatcctgcgcgaactcggacaggtcggcagcttggacttcgtc
gcgcgcgccccgatgggggagtgtgtcgaggacctctcccggcggaccgtcgactccgcg
ctccggaacaaaaccccggcgtcggccgccgccccgatcgccaccacccagtccgaaacc
gccgccacggacggcagcgcaacgccggcgcccacccccgagccggcgccggacacagcg
ccctctccggacagcgacggcgacgacaccgaggcggccgcgccgccgacgctcgccgag
cacgcccgcgcggtcgcggacaccgagaccgcacgccttctcgacgacgcgctcgcccgc
atccgggaggtcccagcggctgaggtcgtcgacgccgtcgccgacgccgactccgtgccg
gcggtcgtcgtcgtggacgccacgatcacccagcgcctgctcgatgtcgccgctcagcgc
ggcgtcgcgtcgctgatcggtgccgacaccgacgagttcgtcaaacagccgcttgccacg
cgcgttcgcaccctcgacgacgcccgcacctga

DBGET integrated database retrieval system