KEGG   Halobacterium salinarum NRC-1: VNG_1969GHelp
Entry
VNG_1969G         CDS       T00038                                 

Gene name
gpdA2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase chain A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00564  Glycerophospholipid metabolism
hal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VNG_1969G (gpdA2)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VNG_1969G (gpdA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 DAO_C FAD_oxidored FAD_binding_3 Thi4 Pyr_redox NAD_binding_8 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AAG20146
UniProt: Q9HNS4
LinkDB All DBs
Position
1452915..1454627
Genome map
AA seq 570 aa AA seqDB search
MAQEPHVVVVGGGSTGAGVARDLAMRGLGVTLVEQGNLTHGTTGRMHGLLHSGGRYAVSD
QASARECIIENRVLREIATHCVDETGGLFVKRPEDSEQYFQEKLAGCEACDIPTKVLSGA
EARQLEPHLADDVEKAIWVPDAAIDPFRLVVANAASAQEHGARIETHSTVTDVVVEDGAV
VGVEVEHATGAGKRVHGTEGGTEVIRADHVVNAAGAWAGRLGEMAGVDVEVRPSKGVMTV
MNTRQVDTVVNRCRPKGDADIVVPHETTCILGTTDEEVADPEDYPEQQWEVDMVIDELAE
LIPMLDDARTVRSFWGVRPLYEPPDVDSDDPTDITRDYFLLAHDDRDDLPGMTTIVGGKL
TTYRMMAEEITDHVCERLGVTADCRTADVALPGSADNTALDDYMTEFGLRSPVAQRSVDR
LGSRAGSVLDTDDPNPTICACEAVTRAEIQDAIEQSGTDLNAVRIRTRATMGNCQGGFCA
HRLANELHTAGYDDATVRASWDELLAERWRGQRHALWGDQLSQAMLSYALHATTQNRGHD
PADADTEIDFTAFDAGPLAADGGPEGAHGN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaaccgcacgtggttgtcgttgggggtgggtcgaccggggccggcgtcgcc
cgcgacctcgcgatgcgtggccttggggtcacgctcgtcgagcagggcaacctcacgcat
ggcacgactggccggatgcacggcctcctccactcagggggccggtacgcagtcagcgac
caggccagcgcgcgcgagtgtatcatcgagaaccgcgtgctcagagagatcgcaacgcac
tgcgttgacgagacaggcgggttgttcgtgaaacggcccgaggacagcgagcagtacttc
caggagaaactcgcgggctgtgaggcctgcgacattcccacgaaggtgctctccggggcg
gaagcccggcagctggagccacacctggccgacgacgtcgagaaggccatctgggtgccc
gacgccgcgatcgacccgttccgcctggtggtcgcaaacgccgcgagcgcccaggagcac
ggcgcgcgcatcgagacacactcgacggtcacggacgtcgtcgtggaggacggcgcggtg
gtcggcgtggaagtcgaacacgcgaccggcgcgggcaagcgcgtgcacggcaccgagggc
ggcaccgaggtgatccgcgccgaccacgtcgtgaacgccgccggcgcgtgggcgggccgc
ctcggtgagatggcgggcgttgacgtcgaggtccgtccgtcgaagggcgtgatgaccgtg
atgaacacgcgacaggtcgacaccgtggtcaaccggtgccggccgaaaggcgacgccgac
atcgtggtgccccacgagaccacctgcatcctggggacgaccgacgaggaggtcgccgac
cccgaggactaccccgaacagcagtgggaggtcgacatggtgatcgacgagttggcggag
ctcattccgatgctcgacgacgcccgcacggtgcggtcgttctggggcgtgcggccgctg
tacgagcccccggacgtcgacagcgacgaccccacggacatcacgcgggactacttcctg
ctcgcgcacgacgaccgcgacgacctgcccgggatgacgaccatcgtcggggggaagctc
acgacctaccggatgatggccgaggagatcaccgaccacgtctgcgagcgcctcggcgtc
accgcggactgtcggaccgcggacgtcgcgctccccgggagcgccgacaacaccgcgctc
gacgactacatgacggagttcgggctgcggtcgccggtcgcccagcgcagcgtcgaccgc
ctcggctcgcgggccggcagcgtgcttgacacggacgaccccaaccccacgatctgtgcc
tgcgaggcggtcacgcgggcggaaatccaggacgccatcgagcagtccgggacagacttg
aacgcggtgcggatccgcacgcgggcgaccatggggaactgccagggcgggttctgcgcg
caccgcctggcgaacgaactccacaccgccggctacgacgacgccaccgtgcgggcgtcc
tgggacgaactgctcgccgagcggtggcgcggccagcgccacgccctctggggcgaccag
ctctcccaggcgatgttgagctacgcgctgcacgcgaccacgcagaaccgcggccacgac
ccggccgacgcggacactgagatcgacttcacggcgttcgacgcggggccgctggcggcc
gacggcggcccggagggcgcgcatggcaattga

DBGET integrated database retrieval system