KEGG   Halobacterium salinarum NRC-1: VNG_1984G
Entry
VNG_1984G         CDS       T00038                                 

Gene name
rnh
Definition
(GenBank) RNAase H
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_1984G (rnh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_1984G (rnh)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     VNG_1984G (rnh)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     VNG_1984G (rnh)
   Elongation factors (archaeal)
     VNG_1984G (rnh)
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-ProteinID: AAG20157
UniProt: Q9HNR3
LinkDB
Position
1464785..1465423
AA seq 212 aa
MARFGVDEAGKGPVLGSMFAAAVAGDPAAVPDGVADSKRLSADRRAELDDRVRASMRVGV
AEVPVDRIDDPETDMNTLTVAAQADALGRVVADGMAGYVDAGDVNEQRFGRRVANRVAAD
VAVTAEHGADDEYDLVAAASIVAKVARDAHVDALAAAFDADIGSGYPSDSTTREFLAAYV
REHGELPECARASWQTSRDALGAAEQSALDEF
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgcggttcggcgtcgacgaggcggggaaagggccggttctcgggtcgatgttcgcg
gcggcggtggccggcgacccggccgccgttccggacggggtcgcggattcgaagcgcctc
agcgccgaccgccgggcggagctcgacgaccgcgttcgggcgtcgatgcgggtgggtgtc
gcggaggtgcccgtcgaccgcatcgacgacccggagacggacatgaacacgctcaccgtg
gcggcccaggcggacgcgctcgggcgggtggtggccgacggcatggcggggtacgttgac
gccggcgacgtgaacgaacagcggttcggccgccgggtggccaaccgggtcgcggccgac
gtggcggtgaccgccgaacacggggccgacgacgagtacgatctggtggcggcggcgagc
atcgtcgcgaaagtcgcgcgggacgcccacgtcgacgcgctcgccgcggcgttcgacgcg
gacatcgggtccggataccccagcgactcgacgacgcgggagttcctggcggcgtacgtc
cgcgagcacggcgaactcccggagtgcgcgcgcgcgagctggcagaccagtcgcgacgcg
ctcggggcggccgagcagtccgcgctggacgagttttag

DBGET integrated database retrieval system