KEGG   Halobacterium salinarum NRC-1: VNG_2181G
Entry
VNG_2181G         CDS       T00038                                 

Gene name
mcm
Definition
(GenBank) MCM / cell division control protein 21
  KO
K10726  replicative DNA helicase Mcm [EC:3.6.4.-]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2181G (mcm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_2181G (mcm)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     VNG_2181G (mcm)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    VNG_2181G (mcm)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid Intein_splicing Mg_chelatase Hint DZR HypA
Other DBs
NCBI-ProteinID: AAG20316
UniProt: Q9HNA5
LinkDB
Position
1613953..1616448
AA seq 831 aa
MDPDLADDYISHPDQLQEAAEEALRVYDLPVDVSLGQAHVRVHGLAEHTDIRAIRAEHLN
TMVSIQGMVRKATDVMPKIQRAVFVCQRCGTDTEVPQGDAGFQEPYQCESCERQGPFKLD
PDRSEFVDSQKLRIQESPEGLGGGETPQSIDVHVEDDATGNVTPGDHVTVTGVLRLDQSE
EATDSPVFEHYMEGSSVVIEDAEFDELNISEADKEEIVALSDHEEIHEEMVDSMAPAIYG
HREAKLAMMLQLFSGVTKHLPDKSRIRGDLHMLLIGDPGTGKCVRGDTTVALADGSEREI
RDLVEANLDDPRPVDDGVWDGVDVAVPSLAADGRLVQRRATKVWKREAPETMYRVRTAAG
HRLTVTPSHPLFVAGSHGPDAVRTEDLEVGQLVGVAPDGDGSGQVAPDGGVIRDAQPAPV
GDAETVAWSAIESITEVEPDEEWVYDLEVEGTHSYLTDGVVSHNSQMISYVQNIAPRSVY
TSGKGSSAAGLTAAAVRDDFGDGQQWSLEAGALVLADNGVAAVDELDKMADDDRSAMHEA
LEQQKISVSKAGINATLKARCSLLGAANPKYGRFDQYEPIGEQIDLEPALISRFDLIFTV
TDQPDPEEDAALADHILQTNYAGELNTQNEELANANYSEAEIESQTEDVAPAIEPGLLRK
YIAYARRTCFPTMTPDARQAIEEFYVDLRSKGADEDAPVPVTARQLEAIVRLAEASARLR
LSDSVEKSDADRVIGIVQSCLQDIGVDPETGEFDADVVETGQSKTQRDRVKNIKALIGEI
EEEFDDGAPVEEVLDRAEEIGMDAGKAEHEIEKLKERGELYQPNTDHLRSI
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggatccggacctggccgacgattacatcagccatcccgaccagctccaggaagccgcc
gaggaggcgttgcgggtgtacgatctgcccgtcgacgtgagcctcgggcaggcacacgtt
cgcgtgcacgggctggccgagcacacggacatccgggcgatccgcgccgaacacctcaac
acgatggtttcgatccaggggatggtgcggaaggccaccgacgtgatgccgaagatccag
cgtgcggtgttcgtctgccagcgctgtggcaccgacacggaggtgccacagggggatgcg
gggttccaggagccgtatcagtgtgagtcctgcgagcgccagggaccgttcaagctcgac
ccggatcggtcggagttcgtggactcccagaagctgcgcatccaggagtcacccgagggg
ttgggcggcggggagacgccacagagcatcgacgtccacgtcgaggacgacgccaccggc
aacgtcacgccgggcgatcacgtcaccgtcaccggcgtcctccggctcgaccagagcgag
gaggccaccgactcgccggtgttcgaacattacatggaagggtcgtcggtcgtcatcgag
gacgccgagttcgacgagttgaacatctccgaggcggacaaagaggagatcgtcgcgctc
tcggaccacgaggagatccacgaggagatggtggattcgatggcgccggcgatctacggc
caccgcgaggccaagctcgcgatgatgctgcagttgttctcgggcgtcaccaaacacctc
cccgataagtcccgcattcggggcgacctccacatgctgctcatcggtgacccgggaacc
gggaagtgcgtgcggggcgacaccacggtggcgctcgccgacggcagcgagcgcgagatc
cgggacctcgtcgaagcgaacctcgacgacccgcggcccgtcgatgacggcgtctgggac
ggtgtggacgtggccgtcccgtcgcttgcagccgacggcaggctcgtgcagcgccgcgcg
acgaaggtctggaagcgcgaagcccccgagacgatgtaccgcgtgcggacggcggccggt
caccggctcaccgtcacgccgagccacccgctgttcgtcgccgggtcgcacggcccggac
gcggtccgaaccgaggatctggaggtcggacagctcgtcggggtcgccccggacggcgac
ggctccgggcaggtcgcacccgacgggggcgtcatccgggacgcacaaccagcgccggtg
ggggacgccgaaaccgtcgcgtggagcgccatcgaatcgattaccgaagtcgaacccgac
gaggagtgggtgtacgacctcgaagtcgaggggacccacagttacctcaccgacggcgtg
gtctcgcacaactcccagatgatctcctacgtgcagaacatcgcgccccggtcggtgtac
acctccgggaaggggtcgagtgcggcggggttgaccgccgcggccgttcgcgacgacttc
ggtgacggccagcagtggagcttggaggcgggcgcgctggtgcttgcggacaacggcgtg
gcggccgtcgacgagctggacaagatggccgacgacgaccggtcggcgatgcacgaggcg
ctcgaacagcagaagatctccgtctcgaaggcgggcatcaacgcgacgctgaaggcgcgg
tgttcgctgttgggcgcggcgaacccgaagtacgggcggttcgaccagtacgagccgatc
ggcgagcagatcgacctggagccggcgttgatctcgcggttcgacctgattttcaccgtg
accgatcagcccgaccccgaggaggacgcggcgctggcggatcacatcctgcagaccaac
tacgccggggagttgaacacgcaaaacgaggaactcgcgaacgcgaactactcggaggcg
gagatcgagagccagaccgaggacgttgcgccggcgatcgagccggggttgttgcggaag
tacatcgcgtacgctcggcggacgtgtttcccgacgatgaccccggacgcgcgccaggcc
atcgaggagttctacgtggatctgcgatcgaagggcgcggacgaggacgcgccggtgccg
gtgaccgcgcgccagctggaggcgatcgtgcggttggcggaggcgtcggcgcggctccgg
ctgtcggattccgtggagaaaagcgacgccgaccgcgtgatcgggatcgtgcagtcgtgt
ctccaggacatcggcgtggaccccgaaacaggcgagttcgacgccgacgtggtcgagacc
gggcagtcgaagacccagcgggatcgtgtgaagaacatcaaggcactgatcggggagatc
gaagaggagttcgacgacggcgcgccggtcgaggaggtcctcgatcgtgccgaggagatc
gggatggacgccgggaaggccgaacacgagatcgagaagctcaaggaacgcggggagctc
tatcagccgaacacggaccacttgcgctcgatctag

DBGET integrated database retrieval system