KEGG   Halobacterium salinarum NRC-1: VNG_2240G
Entry
VNG_2240G         CDS       T00038                                 

Gene name
rfcC
Definition
(GenBank) replication factor C small subunit
  KO
K04801  replication factor C small subunit
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2240G (rfcC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_2240G (rfcC)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     VNG_2240G (rfcC)
SSDB
Motif
Pfam: Rep_fac_C DNA_pol3_delta2 AAA AAA_22 AAA_16 Sigma54_activat AAA_30 Zeta_toxin AAA_24 Mg_chelatase AAA_14 AAA_33 ATPase_2 FtsK_SpoIIIE AAA_18 NACHT AAA_28 AAA_23 ABC_tran IstB_IS21 DUF815 AAA_21 AAA_5 RNA_helicase TniB Adeno_IVa2
Other DBs
NCBI-ProteinID: AAG20362
UniProt: Q9HN59
LinkDB
Position
1667940..1668944
AA seq 334 aa
MDEPLWIDEHAPSLADLPQASVRDRLRDAVDEPVNLVVYGPSGAGKTAAVRALAAAAHDD
PETDLVEVNVADVFGMTKTEISEDPRFASFIDAKRRRNSSKADLVNHVLKETASYSPVSG
GYNTILLDNAEAIREDFQQALRRVMERHHEATQFIIATRQPSKLIPPIHSRCFPVSVRAP
TDNEVVDVLREIVAAEGVDYEPDGLEFVAGYAEGDLREAVLGAQTTAEQEGEVTMNAAYE
ALQDVGSDAAVESMLDDAEAGAFTDARSTLDDLLVDEGMSGGEVLDDLLEVARSRYSGDD
VAELYALAGDVEFDLTRGTSDRVQLGRLLAELGR
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggacgagccgctgtggatcgacgagcacgcgccgtcgctggccgacctcccgcaggcg
agcgtgcgcgaccggctccgggacgccgtcgacgaacccgtgaacctcgtggtgtacggg
ccgtcgggcgcggggaagaccgccgccgttcgcgcgctcgcagcggccgcccacgacgat
ccggagacggatctcgtggaggtgaacgtcgcggacgtcttcgggatgacgaaaacggag
atcagcgaggacccccggttcgcgtcgttcatcgacgccaagcgccgccggaactcctcg
aaggccgacctcgtgaaccacgtcctgaaagagaccgcgagctactcgccggtttcgggc
ggctacaacaccatcctgctggacaacgccgaggccatccgggaggacttccagcaggcg
ctgcggcgggtgatggagcgccaccacgaggccacgcagttcatcatcgcgacccgccag
ccgtcgaagctgatcccgccgatccactcgcggtgtttccccgtctcagtgcgcgcgccg
accgacaacgaggtcgtcgacgtgctccgggagatcgtggccgccgagggcgtcgactac
gagccggacggcctggagttcgtcgcggggtacgcggagggcgacctccgggaggccgtg
ttgggcgcgcagacgaccgccgagcaggagggcgaggtgacgatgaacgccgcctacgag
gcgctgcaggacgtcggcagcgacgccgccgtggagtcgatgctcgacgacgccgaggcc
ggcgcgttcaccgacgcacggtcgacgctggacgacctgctggtggacgaggggatgagc
ggcggcgaggtgctcgatgacctgctggaggtcgcgcgctcgcggtattccggcgacgac
gtggcggagctgtacgcgcttgcgggcgacgtggagttcgatctcacgcggggcaccagc
gaccgcgtgcagctcgggcggctgctcgcggagcttggccggtag

KEGG   Halobacterium salinarum NRC-1: VNG_2280G
Entry
VNG_2280G         CDS       T00038                                 

Gene name
rfcA
Definition
(GenBank) replication factor C small subunit
  KO
K04801  replication factor C small subunit
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2280G (rfcA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_2280G (rfcA)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     VNG_2280G (rfcA)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 RuvB_N Rad17 AAA_16 AAA_assoc_2 AAA_14 ResIII AAA_22 DNA_pol3_delta TIP49 AAA_18 AAA_24 AAA_7 AAA_5 DUF3400 PhoH AAA_11
Other DBs
NCBI-ProteinID: AAG20394
UniProt: Q9HN27
LinkDB
Position
1696383..1697351
AA seq 322 aa
MTDAAGGRQEIWVEKYRPERLEDVVGHPDITERLQSYVDRDDLPHLLFAGPAGTGKTASS
VSIAKELYGDDWQDNFLELNASDERGIDVVRDRIKDFARSSFGGHNYRVIFLDEADALTD
DAQSALRRTMEQFSNNTRFILSCNYSSKIIDPIQSRCAVFRFAQLGDDAVAAHLREIAET
EGLEHTDDGIDALVYAADGDMRRAINALQAASATGDSVNEETVYAITATARPEEIETMVT
EALGGDFAAARATLDDLLTNRGLAGGDIIDQVHRSVWEFDVEEAAAVRLLDRLGEADYRI
AEGANERVQLEALLASVALNAE
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaccgacgccgcgggcggccgccaggagatctgggttgagaagtaccggcccgaacgc
ctcgaagacgtggttggccaccccgacatcaccgagcgcctgcagagctacgtcgaccgc
gacgacctcccccacctcctgtttgcggggccggcgggcaccggaaaaacggcgtcctcg
gtgtcgattgccaaggaactctacggcgacgactggcaggacaacttcctggagttgaac
gccagcgacgaacgcggcatcgacgtggtccgggaccgcatcaaggacttcgcgcggtcg
tcgttcggcggccacaactaccgcgtcatcttcctggacgaggcggacgcgctcaccgac
gacgcccagtcggcgctgcgccgcacgatggagcagttctcgaacaacacccggttcatc
ctctcgtgtaactactcctcgaagatcatcgacccgatccagtcccggtgtgcggtgttc
cggttcgcgcagctcggcgacgacgcggtcgccgcccacctccgtgagatcgccgagacg
gagggcctggaacacaccgacgacggcatcgacgcgctggtgtacgccgcggacggcgac
atgcgccgcgcgatcaacgccctccaggcggcctcggcgaccggcgacagcgtcaacgag
gagaccgtctacgcgatcaccgcgaccgcccgtccagaggagatcgagacgatggtgacc
gaggcactgggcggcgacttcgcggccgcgcgagccacgctggacgacctcctcacgaac
cgggggttggcgggcggcgacatcatcgaccaggtgcaccgctcggtctgggagttcgat
gtcgaggaggcggccgcagtgcggctgctggaccgcctcggggaggccgactaccgcatc
gcggagggcgcaaacgagcgcgtgcaactggaggcgctgttggcgtccgtcgcactgaac
gccgaataa

DBGET integrated database retrieval system