KEGG   Halobacterium salinarum NRC-1: VNG_2254C
Entry
VNG_2254C         CDS       T00038                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18882  DNA primase large subunit
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2254C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_2254C
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    VNG_2254C
SSDB
Motif
Pfam: DNA_primase_lrg
Other DBs
NCBI-ProteinID: AAG20374
UniProt: Q9HN47
LinkDB
Position
complement(1676737..1677819)
AA seq 360 aa
MNARHARYPFLGDARDAVEEAGVDLARVVTEDDAVVERARERVVSALTDGTIGEPAATVS
TRVEVLSYPVARVLVSIVDESVLVRKYATAEADAAYDRFTADESTDTDLKSVSDTTRVSR
DTLLSEFDLRAHVHATPDAHTVDVPTYLLLASSLRDDDWRLVNRALDDGRVPVTDAELDT
LIREAIRERVADGLPLSVPDQIADALDEPVAAIQDALADLDLTREIDTVVPELFPPCMKH
LLDQVQRGDHLPHHARFAITSFLSNVGLSTDEIVDIYEVNPGFGEEMTRYQTDHIQGDSS
PTEYTAPSCATMKAYGNCVNPDDLCDAINHPLSYYEVKLDDGDDDDLADWRDREDDDSPD
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccgccacgcccgctatcccttcctgggggacgcccgcgacgccgtcgaggaa
gctggcgtggacctcgctcgcgtcgttaccgaggacgacgccgtcgtcgagcgcgcccgc
gagcgcgtcgtcagcgcgctcacggacggcacgatcggcgagccggccgccacggtcagc
acccgcgtcgaagtgctgtcctatccggtcgcccgcgtgctggtgtccatcgtcgacgaa
tccgtgctcgtgcgcaagtacgccacggccgaagccgacgcggcctacgaccggttcacc
gccgacgagtccaccgacaccgacctgaaaagcgtctccgacaccacacgcgtctcccgt
gacacgctcctcagtgagttcgatctcagggcacacgttcacgccacaccggacgcccac
acggtggacgtgccgacgtacctgttgctcgcgtcatcgcttcgcgacgacgactggcgg
ctggtcaaccgcgcgctcgacgacggtcgcgtgccggtcaccgacgccgagctcgacacc
ctcatccgggaagccatccgcgaacgcgtcgcggacggcctgcccctctcggtccccgac
cagatcgccgacgccctcgacgagccggtggccgccatccaggacgccctcgcggacctg
gatctcacccgcgagatcgacaccgtcgtgccggagctgttcccgccgtgcatgaaacac
ctcctcgaccaggtgcaacgcggcgaccacctcccacaccacgcccgctttgccatcacg
tcgttcctctcgaacgtcgggctgtcgacggacgagatcgtggacatctacgaggtcaat
ccggggttcggcgaggagatgacgcgctaccagaccgaccacattcagggcgactcaagc
cccaccgagtacaccgcgccgtcgtgtgcgacgatgaaagcctacgggaactgcgtgaac
cccgacgacctctgtgacgccatcaaccacccgctgtcctactacgaggtgaaactcgac
gacggcgacgacgacgacctcgccgactggcgggaccgcgaggacgacgacagccccgat
tag

DBGET integrated database retrieval system