KEGG   Halobacterium salinarum NRC-1: VNG_2256G
Entry
VNG_2256G         CDS       T00038                                 

Gene name
pcn
Definition
(GenBank) proliferating-cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
hal03410  Base excision repair
hal03420  Nucleotide excision repair
hal03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2256G (pcn)
   03410 Base excision repair
    VNG_2256G (pcn)
   03420 Nucleotide excision repair
    VNG_2256G (pcn)
   03430 Mismatch repair
    VNG_2256G (pcn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_2256G (pcn)
   03400 DNA repair and recombination proteins [BR:hal03400]
    VNG_2256G (pcn)
DNA replication proteins [BR:hal03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    VNG_2256G (pcn)
DNA repair and recombination proteins [BR:hal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VNG_2256G (pcn)
   MMR (mismatch excision repair)
    Other MMR factors
     VNG_2256G (pcn)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    VNG_2256G (pcn)
SSDB
Motif
Pfam: PCNA_N PCNA_C
Other DBs
NCBI-ProteinID: AAG20376
UniProt: Q9HN45
LinkDB
Position
complement(1678565..1679308)
AA seq 247 aa
MFKAIVSADTLQETLDSVSVLVDECKIHLDDDTLSIRAVDPASVGMVDLDLAATAFESYE
ADGGLIGVNLSRLEDIAGMADAGQLIQLELDEETRKLHIQIDGLEYTLALIDPDSIRQEP
DIPDLDLPAHVAIEGRDIDRAVTAADMVSDHIALGVDTGDDLFYVNAEGDTDDVHLELAP
DQLIDLDAGDAHSLFSLDYLKDMNKAIPTTAEVELELGDEFPIKLHFDIADAQGHVTYML
APRIQSN
NT seq 744 nt   +upstreamnt  +downstreamnt
atgttcaaggcgatagtaagcgccgacacgctccaggagacactcgactccgtgagcgtg
ctggtggacgagtgcaagatccacctcgacgacgacaccctctccattcgcgcagtcgac
cccgccagcgtcggcatggtcgacctcgatctcgccgccactgcgttcgaatcctatgaa
gccgacggcggcctcatcggcgtcaatctctcccggctggaggacatcgcgggcatggcc
gacgccggccagctcatccaactggaactcgacgaggaaacccgcaagctccacatccag
atcgacggcctcgaatacacgcttgcgctcatcgaccccgactcgatccgccaggaaccg
gacatcccggacctcgatctgcccgcgcacgtcgccatcgaaggccgcgacatcgaccgc
gcggtcaccgccgccgacatggtctccgaccacatcgcgctcggcgtcgacaccggcgac
gacctgttctacgtcaacgccgaaggcgacaccgacgacgtccacctcgaactcgcgccc
gaccagctcatcgacctcgacgccggcgacgcccacagcctgttcagcctcgactacctc
aaggacatgaacaaggccatcccgacgaccgcggaggtcgaactcgaactcggcgacgag
ttccccatcaagctgcacttcgacatcgccgacgcacaaggccacgtcacgtacatgttg
gccccgcgcatccagtccaactga

DBGET integrated database retrieval system