KEGG   Halobacterium salinarum NRC-1: VNG_6199G
Entry
VNG_6199G         CDS       T00038                                 

Gene name
cdc48d
Definition
(GenBank) cell division cycle protein
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
hal  Halobacterium salinarum NRC-1
Brite
KEGG Orthology (KO) [BR:hal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hal03019]
    VNG_6199G (cdc48d)
   04131 Membrane trafficking [BR:hal04131]
    VNG_6199G (cdc48d)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hal04147]
    VNG_6199G (cdc48d)
Messenger RNA biogenesis [BR:hal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     VNG_6199G (cdc48d)
Membrane trafficking [BR:hal04131]
 SNARE
  SNARE associated proteins
   Others
    VNG_6199G (cdc48d)
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    VNG_6199G (cdc48d)
Exosome [BR:hal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VNG_6199G (cdc48d)
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N AAA_2 RuvB_N CDC48_2 AAA_16 AAA_5 AAA_22 TIP49 AAA_33 AAA_14 RNA_helicase IstB_IS21 AAA_18 AAA_7 Mg_chelatase AAA_28 DUF815 AAA_25 AAA_3 ABC_tran TsaE Sigma54_activat AAA_30 AAA_24 AAA_11 DUF2075 NACHT AAA_17 PhoH ATPase NB-ARC Parvo_NS1 Zeta_toxin Bac_DnaA ATPase_2 NTPase_1 Molydop_binding
Other DBs
NCBI-ProteinID: AAG20864
UniProt: Q9HHW2
LinkDB
Position
pNRC200:complement(164190..166403)
AA seq 737 aa
MRLTVKQLKNRDPGSGMAVIDRDALQEIGVSSGDFVAIEGRNGGRTVARVWPSNTSDAGR
GIIRIDGQLRQAANVSIDDRVEVEKTEVEPADRVTVSLPQNLQIRGDLGSHLREHLVDQA
VRAGQTVAFPIGFGMFSGRSGRRIPLRVVDTQPSGTVVVQNTTEIEIADQSAQEVSVESG
EPENTTAPALTYEDIGGLDDELEQVREMIELPMRHPELFGTLGIEPPKGVLLHGPPGTGK
TLIAKAVANEIDAHFQTISGPEIMSKYYGESEEQLRDVFEEAEENAPAIVFIDELDSIAP
KREDVSGDVERRVVAQLLSLMDGLEERGQLTVIGTTNRVDAVDPALRRPGRFDREIEIGV
PDHDGREKILQIHTRGMPLGDGVDLDRYAENTQGFVGADLENLVKESAMHALRRIRPDLD
LDEEEIPADILDSIEVTENDFKEALRGIEPSALREVFVEVPDVTWDHVGGLDDAKERLQE
TVQWPLEHADAYEQVALEPAKGVLLYGPPGTGKTLLAKAVANEANSNFISIKGPELFNKY
VGESERGVREVFSKARENAPTVVFFDEIDAIASERGQGVGDSNVGERVVSQLLTELDGLE
ELEDIVVIATTNRPDLIDDALLRPGRLDRHVAVDEPDEAARREIFEIHTEDKPLAEDVDV
DELVERTDGYVGADIEAVCREAATVAVREYVRATASAESANVDEIELSIEHFEQALEEVD
SNAGSETQAFEKPAEAV
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgcgacttacggtcaaacaactcaagaaccgcgatccagggagcggtatggccgtcatc
gaccgcgatgcgcttcaggagatcggcgtcagcagtggcgacttcgtcgcgatcgagggc
cgcaacggcggacgaacggtcgcccgcgtctggcctagtaacacgagcgacgcgggtcgc
ggtatcatccgaatcgacggccagctccgacaggcagcgaacgtcagcatcgacgaccgc
gtcgaggtcgagaaaacggaggtcgagccggcggaccgagttaccgtctccctaccacag
aatcttcagatcagaggagatctcggctcgcacctccgcgaacatctcgtcgaccaggcg
gtgagggcaggacagacggtcgcgttcccgatcgggtttggtatgttctccggtcggtct
ggtcgacgcattcccctacgggtggtcgatacgcagcccagcgggacggtcgtcgtgcag
aacacgaccgagatcgagatcgccgaccagagcgcccaggaggtctccgtcgaatcggga
gaaccggaaaatacgaccgctccagccctcacgtacgaggacatcggcggcctcgacgac
gaactcgagcaggttcgggagatgatcgagttgccgatgcgccaccccgagctgttcggg
acgctcggcatcgaaccgccgaagggcgttctcctccacggtcctcccgggacggggaag
accctgatcgccaaggccgtcgccaacgaaatcgacgctcacttccagacgatctctggc
ccggagatcatgagcaagtactacggcgagagcgaagagcagcttcgcgacgtgttcgag
gaggccgaggagaacgcgcccgcgatcgtcttcattgacgaactcgactccatcgcgccc
aagcgcgaagacgtcagtggcgatgtcgaacgccgggtcgtcgcccagttgctctcgctg
atggacggcctcgaagagcgcggccagctcacggttatcggcacgaccaaccgcgtcgat
gccgtggatccggcgctccgccgtcccggtcggttcgatcgtgaaatcgagatcggcgtc
cccgaccatgacgggcgcgaaaagatccttcagatccacacgcgcgggatgcctctcggc
gacggcgtcgatctcgaccggtacgctgagaatactcaaggtttcgtcggcgcagatctc
gagaacctcgtgaaagagagcgcgatgcacgcgcttcgccggattcggcccgatctggat
ctcgacgaagaagagatccccgccgacatcctcgactcgatagaggtgaccgagaacgac
ttcaaagaggcgctgaggggcatcgaaccctccgcgctgcgagaggtattcgtcgaggtc
cccgatgtcacctgggaccacgtcggtggtctcgatgatgcgaaggaacgcctccaggag
accgtccagtggcccctcgaacacgccgacgcctacgagcaagtcgcactcgaaccggcg
aagggcgtcttgctctacgggccgcccggcaccgggaagacgctgcttgcgaaggccgtt
gctaacgaggcgaactcgaacttcatctcgatcaaggggcctgagctgttcaacaagtac
gtcggcgagtccgagaggggcgttcgtgaagtgttctcgaaggcccgcgagaacgccccc
acggtggtgttcttcgacgagatcgacgcgatcgcctcggaacgtggccagggcgttggc
gactcgaacgtcggcgaacgcgtggtctcacagctgctgaccgaactcgacggtctcgaa
gaactcgaggacatcgtagtgatcgccacgacgaaccgcccagacctcatcgacgatgcc
ttgctccgaccgggacggctcgaccgtcacgtcgcagtcgacgagcccgacgaagcggca
cggcgtgagatcttcgagatccacaccgaggacaagccgctggccgaagatgtcgacgtc
gacgaactcgtcgagcggactgacggctacgtcggtgccgatatcgaggcggtctgccgc
gaggctgcgacggtcgccgtccgcgaatacgtccgtgcgactgcgagtgccgaatcggcc
aacgtcgacgaaatcgagctgtcaatagagcacttcgagcaggcgctcgaagaggtcgac
tcaaacgctggatccgaaacgcaggcgttcgaaaagccagctgaagccgtgtag

DBGET integrated database retrieval system