KEGG   Halobacterium salinarum NRC-1: VNG_1606G
Entry
VNG_1606G         CDS       T00038                                 

Symbol
gcvT1
Name
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00260  Glycine, serine and threonine metabolism
hal00630  Glyoxylate and dicarboxylate metabolism
hal00670  One carbon pool by folate
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VNG_1606G (gcvT1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VNG_1606G (gcvT1)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VNG_1606G (gcvT1)
Enzymes [BR:hal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     VNG_1606G (gcvT1)
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-ProteinID: AAG19870
UniProt: Q9HPJ7
LinkDB
Position
complement(1195790..1196953)
AA seq 387 aa
MPSRGTHQHTCLRKPYFPGRDGPRMGLRTSPLHGRHEDRGASFTEFGGWNMPVDFDGIQA
EHAAVREAAGIFDVSHMGEIEVSGPDAERLMQRLTTNDVSRLDPGDAQYAAITDDDGIMI
DDTVVYRTPADWPGAFLFVPNAGHDAAAFDRWTDHRDAHDLDASVDNVTTDYGMVAVQGP
DAPDLVAARAGDGVHDLGRFEAATVGVAGVECLVANTGYTGEAGVEIVFPADGAGAVWDA
IANDCQPCGLGARDTLRMEHGFLLSGQDFDPEENPRTPFEAGIGFAVAPESGFVGRDALA
DTDSPEQQFVGLTLDERGVPRHGYAVTTPAGDEIGTVTSGTMSPTLGEPIGLGYVDSAHA
ADGTTVAVRIRGTDKQATITTPPFLDQ
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgccatcgcgggggacgcaccagcacacctgtttacgaaagccttacttcccgggacgc
gacgggccacgtatgggtcttcgaacgtcgccgctgcacggccgacacgaggaccgcggc
gcctccttcacggagttcggcggctggaacatgcccgtcgacttcgacgggatccaggcg
gagcacgccgcggttcgggaggccgcgggcatcttcgacgtctcgcacatgggcgagatc
gaggtgtccgggccggacgccgaacgactgatgcagcgactgaccacgaacgacgtgtcg
cgtctcgaccccggggacgcacagtacgccgccatcaccgacgatgacggcatcatgatc
gacgacaccgtggtctatcgcacccccgccgactggcccggcgcgttcctgttcgtaccc
aacgccggccacgacgcggcggcgttcgaccggtggaccgaccaccgggacgcccacgac
ctcgacgcgtccgtcgacaacgtcaccacggactacggaatggtggccgtccaggggccg
gacgcgcccgacctggtcgcggcgcgcgccggcgatggcgtccacgacctcggacgcttc
gaggccgcgaccgtcggcgtcgcgggcgtcgagtgcctcgtggcgaacaccggctacacg
ggcgaagcgggcgtcgagatcgtgttcccggccgacggcgcgggcgcggtctgggacgcc
atcgcgaacgactgccagccctgcgggctcggcgcgcgggacaccctccgcatggagcat
ggcttcctgctgtccgggcaggacttcgaccccgaggagaacccgcggacgccgttcgag
gcgggcatcggcttcgccgtcgcgccggagtcggggttcgtcgggcgggacgcgctcgcc
gacacggacagccccgaacagcagttcgtggggctgacactggacgagcgtggcgtcccg
cggcacggctacgccgtcacgacccctgctggggacgagatcggaaccgtcaccagcggg
acgatgagtcccaccctgggcgagcccatcgggctcggatacgtcgacagcgcgcacgcc
gccgacggcacgactgttgcggtgcggatccgtggcaccgacaagcaagcaaccatcacg
acaccacccttcctcgaccaatga

DBGET integrated database retrieval system