KEGG   Halobacterium salinarum NRC-1: VNG_1523G
Entry
VNG_1523G         CDS       T00038                                 

Symbol
htr8
Name
(GenBank) Htr8 transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal02020  Two-component system
hal02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VNG_1523G (htr8)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    VNG_1523G (htr8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:hal02035]
    VNG_1523G (htr8)
Bacterial motility proteins [BR:hal02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    VNG_1523G (htr8)
SSDB
Motif
Pfam: MCPsignal DUF948 HAMP DUF599
Other DBs
NCBI-ProteinID: AAG19812
UniProt: Q9HPQ5
LinkDB
Position
1129509..1131440
AA seq 643 aa
MGESARGGGSAETTGGLAAAVKTYLEYTPTGESIPAAAWRRRHRNVRVFVLAHIPLLLAL
GLYEGTESAVTGATIPPTPGILIAAELGIVGALVGLASIPSVSRRGRTALASTAVLASSV
VLVQFSGGFIEAHFHFFVGMAVIAVYEDWLPFALGLVYVVFTHGVFGMINAERVYNHTAA
INNPWVWGGIHGAFVLLLAGALMANWYSTERSREASQKRLEEARQKAQQVEDLEARQAEI
EAEKAEAKRLKADAEEAREAAEAQQREVAALNERLEATANTYGAAMARAADGDLSVRLDP
DVENDAMAAIAASFNEMLDETETTIREIQAVASDVAAASEDADAGVVEIEDASGQVSETV
QEIAAGADEQREKLETVSGEMTDLSAAIEEVAASADSVAERSHETAAVAGDGEQTAEQAI
ADSRTVQSAVESTVQNVEALDDQLAEISEIVDLISDVAEQTNMLALNANIEAARADKSGD
GFAVVADEVKDLAEETRASAGDIEALVADIDAQMQATVTEARTADESVQDAISAVDAVVD
AFGTVAENAEETDTGVQEISTTTDDQAASTEEAVSMIAEVSDISTATAADAQQASTAAEQ
QTTAAATISENTAALREQADRLQGLVSTFDVHDESASTAARSE
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgggggaatccgcacgcggcggcggcagcgctgagacgaccggcggactggctgcagcg
gtcaagacgtatctcgaatacacgccgacgggggagtcgatcccggcggcggcgtggcgg
cgtcgccaccgcaacgttcgcgtgttcgtgctggcgcacatcccgctgttgcttgcgctc
gggctctacgaggggaccgagtccgcagtcacgggcgcgacgatcccgccgacaccgggc
atactcatcgcggcggagctgggtatcgtgggggcgctggtcgggcttgcgtcgatcccg
tcggtgtcccggcggggacgcacggcgctggcctcgacggccgtgctggcgtcctcggtg
gtgctcgtgcagttctccggcgggttcatcgaagcgcacttccatttcttcgtcgggatg
gccgtcatcgcggtctacgaggactggctgccgttcgcgcttggactggtgtacgtcgtg
ttcacgcacggtgtcttcgggatgatcaacgccgagcgcgtctacaaccacaccgccgcg
atcaacaacccgtgggtgtggggtggcatccacggcgcgttcgtgttgctgttggcgggc
gcactgatggccaactggtactccaccgagcgctcgcgggaggcctcccagaagcgcctg
gaggaagcccggcaaaaggcccagcaggtcgaagacctcgaagcccgccaggcggagatc
gaggccgaaaaggccgaagcgaagcggctgaaagccgacgccgaggaggcacgcgaggcc
gccgaagcccaacagcgggaggtcgcggccctgaacgagcgcctcgaagcgaccgccaac
acgtacggggctgcgatggcgcgggccgccgacggtgatctcagcgtgcgcctcgatccc
gacgtcgaaaacgacgccatggcggcgatcgcggcgtcgttcaacgagatgctcgacgaa
acggagaccacgatccgggagatccaggcggtcgccagcgacgtcgcggccgccagcgag
gacgccgatgcgggcgtcgtcgagatcgaggacgccagcggccaggtgagcgagacggtc
caagagatcgccgccggggccgacgagcagcgcgagaaactggagacggtgtccggggag
atgaccgacctgtcggcggccatcgaggaggtggcggcgtccgccgattcggtcgcggag
cgctcgcacgagaccgcggcggtcgccggcgacggcgagcagaccgccgagcaggcgatc
gcggactcccggacggtgcagtcggccgtggagtcgacggtgcagaacgtcgaggccctc
gacgaccagctcgcggagatcagtgagatcgtcgacctcatcagcgacgtcgccgagcag
acgaacatgctggcgttgaacgccaacatcgaggccgcccgcgccgacaagagcggcgac
ggcttcgcggtcgttgctgacgaagtcaaggacctcgcggaggagacgcgggcgtcggcc
ggcgacatcgaggcgctggtcgccgacatcgacgcgcagatgcaggccacggtcaccgaa
gcccggaccgcggacgagagcgtgcaggacgcgatctcagcggtggacgcggtcgtcgac
gcgttcgggaccgtggccgagaacgccgaggagaccgacaccggtgtccaggagatcagc
accaccaccgacgatcaggccgccagcaccgaggaggcggtgtcgatgatcgcggaggtc
agtgacatcagcacggcgaccgccgccgacgcacagcaggcctccacggcggccgaacag
cagaccaccgcggcggcgacgatcagcgaaaacacggccgcgctgcgcgagcaggcggac
cggctgcaggggttggtgtcgacgttcgacgtgcacgacgagtcggcgtcgacggctgcg
cgctcggagtga

DBGET integrated database retrieval system