KEGG   Halobacterium salinarum NRC-1: VNG_1926G
Entry
VNG_1926G         CDS       T00038                                 

Symbol
pdhA1
Name
(GenBank) pyruvate dehydrogenase alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00010  Glycolysis / Gluconeogenesis
hal00020  Citrate cycle (TCA cycle)
hal00620  Pyruvate metabolism
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01120  Microbial metabolism in diverse environments
hal01200  Carbon metabolism
Module
hal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG_1926G (pdhA1)
   00020 Citrate cycle (TCA cycle)
    VNG_1926G (pdhA1)
   00620 Pyruvate metabolism
    VNG_1926G (pdhA1)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     VNG_1926G (pdhA1)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: AAG20114
UniProt: Q9HNV6
LinkDB
Position
complement(1421211..1422179)
AA seq 322 aa
MVRARHFDERALALQRRGWMPGYPPFKGQEGSQVGAAHALAGDDWLFPTYRSNAMQLARG
VPASDLLLFRRGRAEFHSDHDHNVFPQAVPIASQIPHAVGAGMAMSYTDSGQASLAYFGD
GATSEGDFHQGMNFAGVFDAPVVFFCENNNWAISLPRERQTASDSIAAKADAYGFEGVQV
DGNDPLAVYETVTDALAGARDGTPILVESLTYRQGAHTTSDDPDRYRPEEEDLPAWRTAD
PVDRYADYLHDQGVIDAGFVEECFDAAADEIDDAVETAEAAGAPAVDELFDHVYAERTPR
IDDQKAWLESWLETHDPQEMEF
NT seq 969 nt   +upstreamnt  +downstreamnt
atggttcgcgcccggcacttcgacgagcgcgcgcttgccctccaacgccgcggctggatg
cccggatacccaccgttcaaaggacaggaagggtcgcaggtcggggcggcacacgctctc
gccggcgacgactggctgttccccacgtatcgttccaacgccatgcagctcgcccgtggc
gtccccgcaagcgatctgttgctcttccggcgggggcgcgcggagttccactccgaccac
gaccacaacgtcttcccgcaggccgtcccgatcgccagccagatcccgcacgcggtcggc
gcggggatggcgatgtcctacaccgacagcgggcaggcgtcgctggcgtacttcggggac
ggcgcaacctccgagggggacttccaccaggggatgaacttcgcgggcgtgttcgacgcg
cccgtggtgttcttctgtgagaacaacaactgggcgatctcgctgccccgggaacgccag
acggcaagcgactccatcgcggcgaaggccgacgcctacggcttcgagggcgtgcaggtc
gacggcaacgatccgcttgccgtctacgagacggtgaccgacgcgctggctggtgcccgc
gacggcaccccgattctcgtcgagagcctgacctaccggcagggcgcacacacgaccagc
gacgaccccgaccggtaccgccccgaggaggaggacctgccggcgtggcggaccgccgat
ccggtcgaccggtacgccgactacctccacgaccagggcgtcatcgacgccgggttcgtc
gaggagtgtttcgacgcggccgccgacgagatcgacgacgccgtcgaaaccgccgaagca
gccggcgcgcccgccgtcgacgagctgttcgatcacgtctacgccgagcgcacgccccgc
atcgacgaccagaaggcgtggctggagtcgtggctggagacccacgatccacaggagatg
gagttctga

DBGET integrated database retrieval system