KEGG   Halobacterium salinarum NRC-1: VNG_0474G
Entry
VNG_0474G         CDS       T00038                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, subunit alpha
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00010  Glycolysis / Gluconeogenesis
hal00020  Citrate cycle (TCA cycle)
hal00620  Pyruvate metabolism
hal00650  Butanoate metabolism
hal00720  Carbon fixation pathways in prokaryotes
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01120  Microbial metabolism in diverse environments
hal01200  Carbon metabolism
Module
hal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG_0474G (porA)
   00020 Citrate cycle (TCA cycle)
    VNG_0474G (porA)
   00620 Pyruvate metabolism
    VNG_0474G (porA)
   00650 Butanoate metabolism
    VNG_0474G (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VNG_0474G (porA)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     VNG_0474G (porA)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     VNG_0474G (porA)
SSDB
Motif
Pfam: POR_N POR TPP_enzyme_N
Other DBs
NCBI-ProteinID: AAG19013
UniProt: Q9HRZ5
LinkDB
Position
complement(366170..367918)
AA seq 582 aa
MHDDLNWAIGGEAGDGIASTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDQ
VQSVVDRLDILIALTERTVDENLDELHADSIIIYDGDRTEFADFESPAEVTGLDIPLKDL
AEDAGGAIMRNIVALGAVCAVADFPIENLDESLEKRFSGKGEQIIENNKQAARLGAEYVA
EEFEDVTLPYELETTDEDYVLLNGDEAIGMGAIAAGCRFYAGYPITPATDVMEYLTGRIE
QFGGHVVQAEDELAAINLALGAARAGARSMTATSGPGIDLMSETFGLVATSETPLVIANV
MRSGPSTGMPTKQEQGDLNMMLKGGHGEIPRFVVAPTSVAECFHKTVEAFNLAEKYQLPV
YVTADLSMAVTERTYPPEEFDMDAVEIERGKLVDEDEISAWQNDTEQFRPHADTADGISP
RAVPGTEGGVHMSTGLEHDELGRRTEDTDVRVDQVDKRYRKVDTAREREQFDYREFGDSD
ADNLVVSWGSNEGTIVEALEYLDGDDDPDIRVVSVPYIYPRPDLTDEVEAADDVVVVEAN
ATGQFADVIEHDVLERVTRINNYTGVDFKADELAAEITESLA
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcacgacgacctgaactgggccatcggcggggaggccggcgatggaatcgcgtccacc
ggcaagatctttgcgcaggcgctgtcgcgcgccggccggcacgtgttcacctcgaaggac
ttcgcatcacgaatccgaggtgggtacactgcctacaaggtccgtacgtcggtcgaccaa
gtacagagtgtagtcgaccgcctcgacatcctcatcgcgctcaccgaacgcaccgtcgac
gagaacctcgatgagctgcacgcggactccatcatcatctacgacggcgaccgcaccgag
ttcgccgacttcgaatcccccgcggaagtcaccgggctcgacatcccgctgaaggacctc
gccgaggacgccggcggcgcgatcatgcggaacatcgtcgccctgggcgcggtctgtgcg
gtcgcggacttccccatcgagaacctcgacgaatccctcgaaaagcggttcagcgggaag
ggcgaacagatcatcgagaacaacaagcaggcggcccgcctgggtgccgagtacgtcgcc
gaggagttcgaggacgtcacgctcccctacgagctggagaccaccgacgaggactacgtc
ctcctgaacggcgacgaggcgatcggcatgggcgcaatcgcggccggctgccggttctac
gccggctaccccatcaccccggcgacggacgtcatggagtacctcacgggccgcatcgag
cagttcggcggccacgtcgtccaggccgaggacgaactcgcggcgatcaacctcgcgctg
ggtgcggcgcgcgccggcgcgcgatcgatgaccgcgacctccgggccgggcatcgacctg
atgagcgagacgttcggcctggtcgccaccagtgagacgccgctggtgatcgcgaacgtg
atgcggtcgggcccctcgacggggatgccgaccaagcaagaacagggcgacctgaacatg
atgctgaaaggcggccacggcgagatcccgcggttcgtcgtcgcgcccacgtcggtcgcg
gagtgcttccacaagaccgtcgaggcgttcaacctcgcggagaaataccagctccccgtc
tacgtcaccgcggacctctcgatggcggtcaccgagcgcacgtatccgcccgaggagttc
gacatggacgcggtcgagatcgagcgcgggaagctcgtcgacgaggacgagatctccgcg
tggcaaaacgacaccgagcagttccgaccccacgccgacaccgccgacggcatcagcccg
cgcgccgtgccgggcaccgagggcggcgttcacatgtccacgggcctggagcacgacgaa
ctcggtcgccgcaccgaagacacggacgtgcgcgtcgaccaggtcgacaagcgctaccgg
aaagtcgacaccgcccgcgagcgcgagcagttcgactaccgcgagttcggcgacagcgac
gccgacaacctcgtggtctcgtgggggtcgaacgagggcaccatcgtcgaagccctggag
tacctcgacggcgacgacgaccccgacatccgcgtggtgtcggtgccgtacatctacccg
cggcccgacctcaccgacgaggtcgaagccgccgacgacgtcgtcgttgtcgaagccaac
gccaccggccagttcgccgacgtgatcgagcacgacgtgctcgagcgcgtcacacgcatc
aacaactacaccggcgtcgatttcaaagcggacgaactcgccgccgaaatcacggagtcc
ctcgcatga

DBGET integrated database retrieval system