KEGG   Halobacterium salinarum NRC-1: VNG_0876G
Entry
VNG_0876G         CDS       T00038                                 

Gene name
purM
Definition
(GenBank) phosphoribosylformylglycinamidine cycloligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00230  Purine metabolism
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
Module
hal_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VNG_0876G (purM)
Enzymes [BR:hal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     VNG_0876G (purM)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-ProteinID: AAG19319
UniProt: Q9HR39
LinkDB
Position
661987..662982
AA seq 331 aa
MTAGENADGDPDGLTYADAGVDIADSEAATAALVDAASTGTDDTAYAGLVDLGDQYLALA
TDGVGTKLLVAEAVGDYSTVGIDCIAMNVNDLLAAGVEPAAFVDYLAVDEPNERRAAELG
DGLAAGADAAGVALVGGETAVMPDVVRGFDIAGTAAGVATDAELFPGRAEAGDALVGFPS
AGIHSNGLTLAREAATRDGGYDEPYPYEGYETVGDALLEPTRIYTHLLDAFREHGVHAAA
HITGGGWTNLDRMGGFRYEVSDPLPAQPVFDYVQDAGGVSDAEMHRTFNMGTGFVVALPE
DAAAALASQTDGEVVGRVADGDGVSIRGLSL
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactgctggcgagaacgccgatggcgacccggacggactgacctacgccgacgcaggc
gtcgacatcgccgacagcgaggccgcgacggcggcgctcgtcgacgcggcgtcgacggga
accgacgacaccgcgtacgccggcctggtggacctcggcgaccagtatctcgcgctcgcc
accgacggtgtgggcacgaaactgctggtcgccgaggctgttggggactactccacggtg
ggcatcgactgcatcgcgatgaacgtcaacgacctccttgcggcgggcgtcgaaccggcc
gcattcgtggattatctcgctgttgacgaacccaacgagcggcgggcggccgagctcggc
gacggcctggccgccggggcggacgcggccggcgtcgcactcgtgggcggcgagacggcg
gtgatgcccgacgtcgtgcgggggttcgacatcgcgggcaccgcggcgggcgtggccacc
gacgcggagctgttccccggtcgggccgaggccggagacgcgctcgttgggttcccgtcc
gcgggcatccactccaacgggctcacgctcgcccgcgaggcggcgacccgggacggcggc
tacgacgagccgtatccgtacgagggctacgagacagtgggggacgcgctgttggagccg
acgcgcatctacacccatttgctcgatgcgttccgcgagcacggcgtccacgccgccgca
cacatcaccggtggcgggtggacgaacctcgaccgcatgggcgggttccgctacgaggtg
tcggacccgctgcccgcccagccggtgttcgactacgtgcaggacgccggcggcgtcagt
gacgcggagatgcaccggacgttcaacatgggcaccgggttcgtggtcgcgctcccagag
gacgcggcggcggcgctcgcgagccagacggacggcgaggtcgtcggccgcgtcgccgac
ggcgatggcgtctcgatccgcgggctgtcgctgtag

DBGET integrated database retrieval system