KEGG   Halobacterium salinarum NRC-1: VNG_1648G
Entry
VNG_1648G         CDS       T00038                                 

Gene name
trpF
Definition
(GenBank) phosphoribosylanthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01230  Biosynthesis of amino acids
Module
hal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VNG_1648G (trpF)
Enzymes [BR:hal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VNG_1648G (trpF)
SSDB
Motif
Pfam: PRAI
Other DBs
NCBI-ProteinID: AAG19903
UniProt: Q9HPG4
LinkDB
Position
complement(1227011..1227667)
AA seq 218 aa
MTRVKVCGLTTERDHAAAVAAGADAVGIIADVPVETPREVSVETATALRAATPPFVTSVL
VTMPATPEHAVDLVRTVAPDAVQLHGDLPVGDAAYVAANTPCPVIKAVTAGDQSAARYAD
VVDALLVDSPPTDDAGAGGGTGRTHDWAATRAFADRVDTPVVLAGGLTPANVADAVDTVD
PFAVDVASGVEARPGEKDHAAVSAFVARATATPDPTLT
NT seq 657 nt   +upstreamnt  +downstreamnt
atgactcgcgtgaaagtctgcgggctgaccaccgagcgcgaccacgccgcggccgtcgca
gccggcgcggacgcggtcggcatcatcgccgacgtccccgtcgagacgccccgcgaggtc
agcgttgagacggccaccgcgctgcgcgccgccaccccaccgttcgtcaccagtgtcctg
gtcacgatgccggccacccccgagcacgcggtcgacctcgtgcggacggtcgcgcccgac
gccgtccagttgcacggcgatctgccagtcggcgacgcggcgtacgtcgccgcgaacacg
ccgtgcccggtgatcaaagcggtcaccgcgggcgaccagtcggccgcccgctacgccgac
gtcgtcgacgcgttgctcgtcgactccccgccgacggacgacgccggtgccggcggcggc
accggccgcacacacgactgggccgcaacccgcgcgttcgccgaccgtgtcgacacgccg
gtcgtgctcgccggcggactcaccccagcgaacgtcgccgacgcggtcgacaccgtcgac
ccgttcgccgtggatgtcgcctccggcgtcgaggcgcgtcccggcgagaaagaccacgcg
gccgtctcggcgttcgtcgcgcgcgccacagccacgcccgaccccaccctcacatga

DBGET integrated database retrieval system