KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_0678Help
Entry
HTSR_0678         CDS       T04517                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Pathway
halh00240  Pyrimidine metabolism
halh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HTSR_0678
Enzymes [BR:halh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HTSR_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AOW79870
UniProt: A0A1D8S3D5
LinkDB All DBs
Position
637501..638088
Genome map
AA seq 195 aa AA seqDB search
MRAIRENGWVEVISGSMFSGKTEELLRRLRRAEIAGQEVVAFTPAVDDRYGQAELGSHAG
HTWEATVVDNTAEGVRSIPDRADGASVVAIDEANFFPEELVSVANELATAGRRVIVSGTD
QTYRGEPFEPLGQLMATAEYVDKLRAICAVCGEPATRNQRLVDGEPAHVDEPTIVVGAEE
SYEARCRSCHEVRTD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgatcagggaaaacgggtgggtcgaggtcatttccggctcgatgttctcgggg
aagaccgaggaactcctgcgacgactccgccgtgcggagatcgccggccaggaggtcgtg
gcgttcacgccggcggtggacgaccgctacgggcaggccgaactcgggtcccacgccgga
cacacctgggaggcgactgtcgtggacaacacggccgagggggtgcgctcgattcccgac
cgggccgacggcgcctcggtcgtcgccatcgacgaggcgaacttcttccccgaggaactg
gtctccgtcgcaaacgagctagcgaccgccggtcgccgcgtgatcgtcagcgggaccgac
cagacctaccgtggcgaacccttcgagccgctggggcaactcatggcgaccgccgagtac
gtcgacaaactccgggcgatctgtgcggtctgtggcgagccggccacccgcaatcagcgc
ctggtcgacggcgaacccgcacacgtcgacgagccgacgatcgtggtcggtgccgaagag
tcctatgaggcgcggtgtcgaagctgccacgaggtccgaacggactga

DBGET integrated database retrieval system