KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_1107Help
Entry
HTSR_1107         CDS       T04517                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Pathway
halh00290  Valine, leucine and isoleucine biosynthesis
halh00770  Pantothenate and CoA biosynthesis
halh01100  Metabolic pathways
halh01110  Biosynthesis of secondary metabolites
halh01130  Biosynthesis of antibiotics
halh01210  2-Oxocarboxylic acid metabolism
halh01230  Biosynthesis of amino acids
Module
halh_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
halh_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:halh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HTSR_1107 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HTSR_1107 (ilvD)
Enzymes [BR:halh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     HTSR_1107 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AOW80287
UniProt: A0A1D8S4K7
LinkDB All DBs
Position
complement(1047998..1049731)
Genome map
AA seq 577 aa AA seqDB search
MPDQGDSDLFHYEKDPSLPSNEVVQGAERAPHRAMFRAMDYDDEDLASPMIGIANPAADI
TPCNVHLDAVAESAREGIDSAGGMPIEFGTITISDAISMGTEGMKASLISRELIADSVEL
VAFGERMDGLVTLGGCDKNMPGMMMAAIRTDLPAVFLYGGSIMPGEHDGREITIQNMFES
VGAVSSGKMEPEELDRMERVACPGPGSCGGMFTANTMASIAETLGFAPLGSASPPAEHDS
RYQEAERAGRLAVEVVSERRRPSDFLTRESFENAIALQVAVGGSTNAVLHLLAMAAEAGV
DLDIETFNEVSARTPKIAHLQPGGSRVMNDLHEIGGVPVVLSALHDAGLLHGEAMTVTGR
SLAAELDRIDPPSIDTLDVSFLHPVEDPIHERGAIRILTGNLAPDGAVIKITGKDHLAHE
GPVRVFESEEPAMEYVEAGQVESGDVICIRNEGPRGGPGMREMLGVTSAVAGQGHADDVA
LFTDGRFSGATRGFSIGHVAPEAFVGGPIAALEDGDQVRIDIDELELSVDLTPAEIEDRL
DDHDPEPTYENGVLAKYHRDFGSAANGAVSNPGVQWD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccagggagattccgacctgttccactacgagaaggacccctcgttgccgagc
aacgaggtcgtccagggcgccgaacgggccccacatcgggcgatgtttcgggccatggac
tacgacgacgaggacctcgcgtcgccgatgatcggtatcgcgaatccggccgcggatatc
acgccgtgtaacgtccacctcgatgccgtcgccgagagcgctcgggagggaatcgattcg
gcgggtgggatgcccatcgagttcggcactatcactatttccgacgccatctcgatggga
actgaggggatgaaggcgtcgttgatctcccgtgaattgatcgccgattccgtcgaactg
gtcgccttcggtgaacggatggacggcctggtcacactgggtggctgtgataagaacatg
ccgggcatgatgatggccgcgatcaggactgacctccccgcggtcttcctctatggcgga
tcgatcatgccgggcgaacacgacggtcgggaaatcacgatccaaaacatgttcgagagc
gtcggggcggtcagctccggcaagatggaaccggaggaactggaccggatggaacgagtg
gcctgtccgggaccggggtcctgtggtgggatgttcacggccaacacgatggcttcgatc
gcggagacactggggtttgcaccgctggggtctgcctcgccaccagccgaacacgactcc
cggtaccaggaggccgaacgcgccggtcgactggccgtggaagtcgtctcggaacgacgc
cgcccttcggactttctaacccgggaatccttcgaaaacgccatcgcgctccaggttgcg
gtcggcgggtcgaccaacgccgtgctacatctactcgcgatggccgccgaagccggtgtg
gacctcgacatcgagacgttcaacgaggtgagcgctcgcacgccgaagatcgctcacctc
cagccaggggggagccgcgtcatgaacgacttgcacgaaatcggtggcgtccccgttgtt
ctatcagccctgcacgacgctggtctgctccatggagaggctatgaccgtgacgggtcgg
agcctcgcggcggagctcgatcggatcgatccaccgtcgattgacacacttgacgtttcc
ttcttgcaccccgtcgaggatccgattcacgagcggggagcgattcgaattctcactggc
aacctcgcgccggatggtgcggtcattaaaatcaccggaaaggatcaccttgcccacgag
ggcccagtccgtgttttcgagtcggaggagcctgcgatggagtacgtcgaggcgggtcag
gtcgaatctggggatgtcatctgtatccggaacgagggtccgcgaggtggcccgggaatg
cgcgaaatgctcggcgttacctcggccgttgccggccagggccacgccgatgacgtcgct
ctgtttactgacggtcggttctccggcgcgactcggggattctcgatcgggcacgtggct
cccgaggcgttcgtcgggggcccgattgccgcgctcgaagacggcgatcaggtccgaatc
gatatcgacgaactcgagctatcggtcgacctgacaccggcggagatcgaggaccggctc
gacgatcacgatcccgagccaacgtacgagaacggtgttctggcgaagtaccatcgggac
ttcgggtcggcggccaacggggccgtctcgaatcctggcgtccagtgggactag

DBGET integrated database retrieval system