KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_1161Help
Entry
HTSR_1161         CDS       T04517                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Pathway
halh00630  Glyoxylate and dicarboxylate metabolism
halh01100  Metabolic pathways
halh01120  Microbial metabolism in diverse environments
halh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:halh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HTSR_1161 (rbcL)
Enzymes [BR:halh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     HTSR_1161 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AOW80341
UniProt: A0A1D8S4Q5
LinkDB All DBs
Position
complement(1097392..1098639)
Genome map
AA seq 415 aa AA seqDB search
MTGIAYADFVDTDYQPAPEELVCDFAIEPASGLSMEDAAGRVASESSNGTWAALAVGDDF
TDVGATAFEIGDGTIRVAYPETLFEFGNMPQALSCVAGNIMGMKAVDSIRLQDCSWPADL
ARSFRGPQFGSAVKEAFLDAEDRPALATVPKPKVGLSTKRHAEIGYEAWTGGIDLLKDDE
NLTDQSFNSFADRVTESFEMRDRAEEETGDRKDYLVNITADVETMKERADFVADQGGNFV
MVDVITTGWGAVQSVREHTEKRGLAIHAHRAMHAAFDRLSHHGVSMRVLAQIARLTGVDH
IHTGTANLGKLENEDTAGINEWLQSDLHGMNDVLPVASGGLHPGTVEPLLDALGTDLIVQ
AGGGIHGHPDGTHAGAKALRQAVDAYMAGKSVTEAGESHDELGRALEEWGAETPI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggattgcctacgcggacttcgtggatacggactaccagccagcgcccgaggaa
ctcgtctgtgattttgccatcgaacccgcgtcggggttgtcgatggaagacgcagccggg
cgtgtcgcctcggaaagttccaatggaacctgggccgcactggcggtcggcgacgacttc
accgacgtgggcgcgacagccttcgagatcggtgacggaacgattcgtgtcgcctacccc
gagacgctgttcgagttcggaaacatgccccaggccctctcctgtgtcgcgggcaacatt
atggggatgaaggccgtggactcgattcgcctccaggactgttcgtggccggccgacttg
gccaggtccttcaggggcccccagttcggttcggccgtcaaagaagcgttcctcgacgcc
gaggaccggcccgcactggcgacggtccccaagccgaaagttgggctctcgacgaagcgc
cacgccgagatcggctacgaggcctggaccggcggcatcgacctgctgaaagacgacgag
aacctgaccgaccagtccttcaacagctttgccgaccgggtcaccgagagcttcgagatg
cgggatcgggcagaggaggagaccggagaccgcaaggattacctggtaaacatcaccgcc
gacgtcgagacgatgaaagagcgggccgacttcgtggccgaccagggcgggaacttcgtc
atggttgatgtcatcaccaccggctggggcgcggtccagtcggtccgggagcacaccgaa
aagcgcgggctcgcgatccacgctcaccgggcgatgcacgcggccttcgatcggctctcc
caccacggcgtctcgatgcgcgtgctcgcccagatcgctcgcctcacgggtgtcgatcac
attcacaccgggacggcgaacctgggaaaactcgaaaacgaggacacggcgggcatcaac
gagtggctacaatccgacctgcacgggatgaacgacgtcctcccggtcgcgtccggcggc
ctccaccctggcacggtcgaaccactcctggacgcgttgggcacggacctcatcgtccag
gctggcggtggcatccacggtcatcccgacgggactcacgccggcgcgaaagcgctccgc
caggcggtcgacgcctacatggccggcaagtcagtcacggaggcgggcgagagccacgac
gaactcggccgcgcactcgaggagtggggcgcagagacgcctatctga

DBGET integrated database retrieval system