KEGG   Halorientalis sp. IM1011: BV210_01295Help
Entry
BV210_01295       CDS       T04693                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00630  Glyoxylate and dicarboxylate metabolism
hali01100  Metabolic pathways
hali01120  Microbial metabolism in diverse environments
hali01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BV210_01295
Enzymes [BR:hali01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BV210_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AQL41431
UniProt: A0A1Q1FF31
LinkDB All DBs
Position
245038..246285
Genome map
AA seq 415 aa AA seqDB search
MPGINYEDFLDLGYEPRDSDLICTFAVEPASDMDMDDAAGRVASESSNGTWAELQVEGSI
TDLSATACAIDDNRVTVAYPDALFEDGNMAQVLSCIAGNIMGMKAVERIRLLDCDWPEPL
ATSFPGPQFGTGVREEIFDAGDRPITATVPKPKVGLSTDQHAQIGYEAWTGGLDLLKDDE
NLTSQDFNPFGDRLTESLAQRDRAEDETGERKSYLVNVTADTRRMLERVDMVAEHGGEYV
MVDVVTCGWAAVQRVRERCEEHGLAIHAHRAMHAAFDRIPDHGVSMRVIAQVARLCGADQ
LHTGTADLGKLENEDTTGINEWLYSDLYGLHDVLPVASGGLHPGLVPELIDRVGTNVCVQ
AGGGVHGHPDGTHAGAKALRAAVDAAASGENIESKAEDVPELATAIEMWGTETPR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcatcaactacgaggacttcctcgacctcggctacgaaccccgcgattcggat
ctgatctgtaccttcgccgtcgaacccgcgagcgacatggacatggacgacgcggccggc
cgcgtcgcctccgagagttccaacggcacgtgggccgaactccaggtcgaggggtcgatc
accgacctctcggcgacggcctgtgctatcgacgataatcgggtcacggtggcctacccc
gacgcgctgttcgaggatggcaacatggcccaggtcctctcgtgtatcgccggcaacatc
atgggcatgaaagccgtcgagcgcatccgcctgctggactgtgactggcccgaaccgctg
gccacctccttccccggaccgcagttcggaaccggcgtccgcgaggagatcttcgatgcg
ggcgaccgcccgatcacggcgacggtgcccaaaccgaaggtcggactgtcgaccgatcag
cacgcacagatcggctacgaggcctggaccggcgggctcgacctgctcaaggacgacgag
aacctcacgagtcaggatttcaaccccttcggggaccggctcacggagtcgctcgcccag
cgcgaccgcgccgaggacgaaaccggcgagcggaagtcctacctcgtgaacgtcacggcc
gacacccggcggatgctcgaacgggtcgacatggtggccgaacacggcggcgagtacgtc
atggtcgacgtggtgacctgtggctgggcggccgtccagcgggttcgcgagcgctgcgag
gagcacggcctcgccatccacgcccaccgcgcgatgcacgccgccttcgaccggattccc
gaccacggggtatcgatgcgcgtcatcgcacaggtcgcccggctctgcggtgccgaccag
ttgcacaccggtaccgccgacctggggaaactcgaaaacgaggacaccacggggatcaac
gagtggctctattccgatctgtacggcctgcacgacgtcctcccggtcgcgtcgggcggc
ctccaccccgggctcgttccggaactgatcgaccgggtgggaaccaacgtctgcgtgcag
gccggcggcggcgtccacggccaccccgacggcacccacgctggcgcgaaagcgctccgg
gcggcggtcgacgccgccgcttccggcgagaacatcgagtcgaaggccgaggacgtgccg
gaactcgcgactgccatcgagatgtggggaaccgagacgccgcggtga

DBGET integrated database retrieval system