KEGG   Halorientalis sp. IM1011: BV210_12360Help
Entry
BV210_12360       CDS       T04693                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00564  Glycerophospholipid metabolism
hali01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BV210_12360
Enzymes [BR:hali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BV210_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 DAO_C Pyr_redox 3HCDH_N Lycopene_cycl GIDA FAD_oxidored DUF3606 ApbA Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AQL43435
UniProt: A0A1Q1FKR6
LinkDB All DBs
Position
complement(2411275..2412981)
Genome map
AA seq 568 aa AA seqDB search
MPDAPTVLVIGGGSTGCGIARDLAMRGLDVTLVEQGNLTHGTTGRMHGLLHSGARYAVSD
RDSARECIAETRVLEDIASHCVEETGGLFVKRPEDSEAYFERKLQGCEACGIPAEVLSGR
EARQREPYLAEDVDKAIAVPDGAVDPFRLCVANAASAENHGARIETHAEVTDLLVESGEV
VGAEIEHGSGPGTRSHRSPGATERIEADHVINATGAWAGGIGEMAGVDVDVRPSKGVMTV
MNVRQVDTVINRCKPKGNADIVVPHETTCILGTTDEEVEDPEDYPEEQWEVDLVIEELSK
LLPVLQEARTIRSYWGVRPLYEPPGSGTADSEDITRDFFLLDHADRDGLPGLTTIVGGKF
TTYRMMAEDVSDHVCDRLGVSATCRTAEVPLPGSRDERVLDDAMDAFGLSSPVARRSKQR
LGDRASDVLDTDEPNPVVCSCEGVTRAELRDAIGQSGTDLNAVRIRTRASMGNCQGGFCA
HAMADELHPEYDPEQATAALDELYQERWKGQRHALWGEQLSQAMLTYALHAATMNRDRAA
RSAAGSRTEADDRTVDFEAFDGGAPGGD
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgcaccgacggtgctggtgatcggcggcgggtcgacgggctgtggcatcgcg
cgggacctggcgatgcgcggactcgacgtgacgctcgtcgagcaggggaacctgactcac
gggacgaccggccggatgcacggcctgctccacagcggcgcgcgctacgccgtctccgac
cgggacagcgcccgggagtgcatcgccgagacccgcgtcctcgaagacatcgcgagccac
tgcgtcgaggagaccggtggcctgttcgtcaagcgtcccgaagacagcgaggcgtacttc
gagcggaaactccagggatgtgaggcgtgtggcatccccgccgaagtcctctccgggcgg
gaggcccgccagcgcgaaccctacctcgccgaggacgtggacaaggccatcgcggtgccc
gacggggcagtcgaccccttcagactctgcgtggccaacgccgcgagcgccgagaaccac
ggtgcgcggatcgagacccacgccgaagtgaccgacctgctcgtcgagtccggcgaggtc
gtcggggcggagatcgaacacgggagcggaccggggacgcggagccaccgcagccccggc
gcgaccgagcggatcgaggccgaccacgtgatcaacgcgacgggtgcctgggcgggcgga
atcggcgagatggccggcgtcgacgtggacgttcgcccctcgaaaggcgtgatgacggtg
atgaacgtccggcaggtcgacaccgtcataaatcggtgcaagccgaagggcaacgccgac
atcgtcgtgccccacgagaccacctgcatcctcgggacgaccgacgaagaggtcgaggac
cccgaggactaccccgaagaacagtgggaggtcgacctcgtgatcgaggaactgtcgaaa
ctcctccccgttctgcaggaggcccgaaccatcagatcctactggggggtgcggccgctg
tacgaaccgccgggctcgggaactgcggactccgaggatatcacccgcgatttcttcctg
ctcgaccacgccgaccgggacggcctgcccggactcaccaccatcgtcggcgggaagttc
accacctaccggatgatggccgaggacgtcagcgatcacgtctgtgatcgactgggtgtc
tcggcgacctgccggaccgccgaggtgcccctgccgggaagtcgcgacgagcgcgtcctc
gacgacgcgatggacgcgttcgggctcagttcgccagtcgctcgtcggagcaaacagcgg
ctcggcgaccgcgcgtccgacgtgctcgacaccgacgagcccaatcccgtggtctgttcc
tgcgagggcgtcacccgtgcggaacttcgggacgccatcggccagtcggggacggacctc
aacgcggtccgcatccggacgcgcgcgtcgatgggcaactgtcagggcggcttctgtgcc
cacgcgatggcagacgaactccatcccgagtacgaccccgagcaggccaccgcggcgctg
gacgaactgtaccaggagcgctggaagggccagcgccacgcgctgtggggcgaacagctc
tcacaggcaatgttgacctacgcactgcacgcggcaacgatgaaccgggatcgggcggcg
cggagtgccgccgggagtcggacggaggccgacgaccgcaccgtcgacttcgaggccttc
gacggaggtgctcctggtggcgattga

DBGET integrated database retrieval system