KEGG   Halomonas alkaliphila: CUU95_00275Help
Entry
CUU95_00275       CDS       T05720                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
halk  Halomonas alkaliphila
Brite
KEGG Orthology (KO) [BR:halk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CUU95_00275
Enzymes [BR:halk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CUU95_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO Glutaredoxin K_oxygenase Thi4 FAD_oxidored FMO-like Methyltrn_RNA_4 DUF2190 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AYF32359
UniProt: A0A386WZ56
LinkDB All DBs
Position
48897..50453
Genome map
AA seq 518 aa AA seqDB search
MLDANLKNQLKAYLEKVTQPFEIVASLDDGAKSRELLGLLEDISGLCDKITLQTDGQDNR
TPSFAINRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKTSEELLNQIKALDGEMLF
ETYYSLSCQNCPDVVQALNLMAIFNPNVRHVAIDGALFQDEVEAREIMSVPSIYLNGKPF
DQGRMTLEQILAKVDTGAAEREAKKLSEKAAFDTLVIGGGPAGASAAIYSARKGINTGVA
AERFGGQVADTMGIENFISVSHTEGPKLVSALEEHVKEYDVDVMNLQRATSFKAAENEGD
LHEITFESGAKLKSKTLVLATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQKKLKSLPNVDIILNAETTEVTGDG
SRVNGLAYKDRNTDELKTIALEGIFVQIGLVPNTEWLKGSPIEMTPRGEIIVDAHGMTSV
PGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatttaaaaaatcagttgaaagcttatttagaaaaagtgactcaaccg
ttcgagatcgttgcgtccctcgatgacggtgccaagtcacgtgaattgctaggtttgctc
gaagacatcagcggcctatgcgacaagattacactacaaactgacggtcaagataatcgc
acgccgtcatttgccattaaccgccccggcgaagaaaccggcgtggtatttgctggcatc
ccgatggggcacgagttcacctcgctggtgctggcactgctacaagtgggtggacaccct
ccaaaaacgtccgaagaactgctaaatcaaatcaaggcgcttgacggcgaaatgctgttc
gagacgtattactcgctctcctgccaaaactgcccagacgttgttcaagcgctcaacttg
atggcgattttcaacccaaatgttcgccacgtggccatcgatggcgcactgttccaagat
gaagtcgaagctcgggaaatcatgtcggttcccagcatctatttaaacggtaaaccgttt
gaccagggacgtatgaccttagagcagattctagccaaggttgatacaggtgctgccgaa
cgagaagcgaaaaaacttagcgaaaaagccgcctttgatacgctggtaattggtggtggc
cctgcaggtgcctcagcagcaatctactctgcccgtaaagggatcaacacaggcgttgct
gctgagcgtttcggtggacaggtggcagacaccatgggcattgaaaacttcatctccgtc
agccataccgaaggccctaaactggttagcgctctggaagagcatgttaaagagtatgac
gttgacgttatgaaccttcagcgcgccacatcgtttaaagcagctgaaaacgaaggtgat
ttgcacgaaataaccttcgagtcgggcgctaagctgaagagtaaaaccctcgtcctggca
accggtgcgcgttggcgcgagatgaatgtgcctggcgaacaacagtatcgcaacaaaggc
gttgcttactgcccccactgcgatggcccgctatttaaaggcaagcgcgtagcagtgatt
ggcggcggcaactctggcgttgaggccgctatcgacctggccggtattgtaggccacgtc
accctagtcgagtttatgggtgagatgcgtgcagacgccgtgctacagaaaaagcttaag
agcctgcctaacgtcgacattattttaaacgctgaaaccacggaagtgacaggcgacgga
agccgggttaacggcttagcctataaagatcgcaataccgatgagctgaaaaccatcgca
ctagaaggcatctttgtgcaaattggcttagtgcctaataccgaatggctgaaaggctca
ccgattgaaatgacgccacgcggtgaaatcattgtcgatgcccatggcatgacgtcagtt
ccaggcgtatttgctgcaggcgacgtgactaccgtgccatacaagcaaattattatcgcc
atgggcgagggtgcaaaagcatcactgggtgcgtttgactatttgattcgccactaa

DBGET integrated database retrieval system