Vreelandella alkaliphila: CUU95_01880 Help Entry CUU95_01880       CDS       T05720                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism halk  Vreelandella alkaliphila Pathway halk00362   Benzoate degradation halk00621   Dioxin degradation halk00622   Xylene degradation halk01100   Metabolic pathways halk01120   Microbial metabolism in diverse environments halk01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:halk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CUU95_01880    00622 Xylene degradation     CUU95_01880    00621 Dioxin degradation     CUU95_01880 Enzymes [BR:halk01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CUU95_01880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF1904 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AYF32648 UniProt:  A0A386WYU8 LinkDB All DBs Position complement(397204..397398) Genome browser AA seq 64 aa AA seqDB search MPIVTIQQFPRDLAQKRELAKRITDVFCDVYGADPVSVQVFFQEVTQENWSKGGQMGVDR DTAQ NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgcctatagtcactatccagcaattcccccgtgatcttgcgcaaaagcgagaattggca aagcgtattactgacgtattctgcgatgtgtatggcgccgatccggtgagcgtgcaggtg ttttttcaagaagtaacgcaggaaaattggtccaaaggcggccaaatgggggttgatcgt gatactgctcagtga

DBGET integrated database retrieval system