KEGG   Halomonas alkaliphila: CUU95_05180Help
Entry
CUU95_05180       CDS       T05720                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
halk  Halomonas alkaliphila
Pathway
halk00061  Fatty acid biosynthesis
halk01100  Metabolic pathways
halk01212  Fatty acid metabolism
Module
halk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:halk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CUU95_05180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:halk01004]
    CUU95_05180
Enzymes [BR:halk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CUU95_05180
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CUU95_05180
Lipid biosynthesis proteins [BR:halk01004]
 Fatty acid synthase
  Component type
   CUU95_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AYF33258
UniProt: A0A386X0U8
LinkDB All DBs
Position
1103598..1104113
Genome map
AA seq 171 aa AA seqDB search
MTKQHSFDREELLACSRGELFGPGNAQLPAPNMLMLDRIMHIHEEGGAHGKGELIAELDI
TPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFYLGWLGHPGRGRALGCGDVKFSGQILPD
AKKVTYHINVKRIITRRLILGIADGTVSVDGRDIYQANDLRVGLFTSTANF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagcaacattcctttgatcgcgaagaactgctggcctgctcgcgcggcgagcta
tttggcccaggaaacgcacagcttccggctcccaacatgctgatgcttgatcgcatcatg
cacattcacgaagaaggtggtgcgcatggtaaaggcgagctaatcgccgaattggacatc
accccggatctgtggttttttgattgccacttccccggcgacccagtcatgccaggctgt
ttggggctagatgccatgtggcagcttgtgggtttctacctgggttggcttggccaccca
ggccgtggacgggcactgggctgtggcgacgtcaaattcagcggccaaattctacccgac
gcgaaaaaagtgacgtatcacattaatgtgaagcgcattattacccgtcggcttattcta
ggcatcgccgacggcaccgtgtctgtcgacggacgcgatatataccaggctaatgatctg
cgcgttggcctattcacctccactgcgaatttctga

DBGET integrated database retrieval system