KEGG   Halomonas alkaliphila: CUU95_06385Help
Entry
CUU95_06385       CDS       T05720                                 

Gene name
antB
Definition
(GenBank) anthranilate 1,2-dioxygenase small subunit
  KO
K05600  anthranilate 1,2-dioxygenase (deaminating, decarboxylating) small subunit [EC:1.14.12.1]
Organism
halk  Halomonas alkaliphila
Pathway
halk00627  Aminobenzoate degradation
halk01100  Metabolic pathways
halk01120  Microbial metabolism in diverse environments
Module
halk_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:halk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CUU95_06385 (antB)
Enzymes [BR:halk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     CUU95_06385 (antB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 SnoaL_2 FerA
Motif
Other DBs
NCBI-ProteinID: AYF33477
UniProt: A0A386WY93
LinkDB All DBs
Position
1365938..1366423
Genome map
AA seq 161 aa AA seqDB search
MSQQQSIEQFLYQVAELCDSQDWDAYLDQFAPECEFHIPQWKGDHEITQDPKREMSLMYY
ADRTGIEDRIFRLRTGKSAASTPMPRTLHLINNVRWAPRDDGQVQAKVNWVTHFHRFGES
GYFFGTASYTLRGDGDDWKITRKHTVLLNDKIDSVLDFYHV
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagcaatccatcgaacagtttctctatcaggtcgccgaactttgtgacagc
caggattgggatgcttatttagaccagttcgccccagagtgtgagtttcatatccctcag
tggaagggcgaccatgagatcacccaggacccgaagcgtgagatgtcgctgatgtactac
gcggaccgcacgggcattgaggatcgcatcttccgcctgcgtactggcaagtccgctgct
tccacgccgatgccccgcacgctgcatctgattaataacgtgcgctgggcgccacgtgat
gatggtcaggtgcaggctaaggtgaactgggtcactcacttccaccgcttcggtgagagc
ggctacttcttcggcacggccagctatacgctgcgtggtgacggcgacgactggaagatt
acccgcaagcacacggtactgctcaacgacaagatcgattccgtcttggatttctaccac
gtctga

DBGET integrated database retrieval system