KEGG   Halomonas alkaliphila: CUU95_10110Help
Entry
CUU95_10110       CDS       T05720                                 

Definition
(GenBank) transcriptional regulator
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
halk  Halomonas alkaliphila
Pathway
halk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:halk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUU95_10110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:halk02000]
    CUU95_10110
Enzymes [BR:halk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CUU95_10110
Transporters [BR:halk02000]
 Other Transporters
  Pores ion channels [TC:1]
   CUU95_10110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 HTH_11 GST_N GST_N_2 GST_C_2 HTH_20 GST_C
Motif
Other DBs
NCBI-ProteinID: AYF34134
UniProt: A0A386X6K8
LinkDB All DBs
Position
2203973..2204821
Genome map
AA seq 282 aa AA seqDB search
MSQAHRLPKLLKMLRHYDDPVSGADLSEALGIPLSVLYKDIAVLRAVGVEIVSEPGQGYV
LPPSAQLPPPTLCEPAAERSDELVFYTHPLSRGGIVHWMLEELGVPYRLVVLEYGATMHS
PDYLAINPMGKVPAIRHGERVVTEAAAICAYLADAFPEAGLAPPLSARDDYYRWLFFAAG
PLEAAASLNSLGFQPNAEQRMRLGSGDFATVIEALAAAVNGRRYIAGDAFSAADVYVGSH
IGWGMQFGTLPRRPEFEHYWAGMQNRPARQHCEMFIQQALAQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagcccaccgtttgccaaaactactcaaaatgctgcgtcactacgacgatcca
gtcagcggtgcggatttgtctgaagcgctaggtataccgctgagtgttctctacaaagat
attgctgtgcttagagccgttggggtcgagattgttagtgaaccaggccaaggctatgtg
ctcccgcctagcgctcaattacctcccccaacgctttgcgagccagccgccgaacggtct
gacgaactggttttctatacgcatcccctttcgcggggaggcattgtgcactggatgctt
gaagagcttggtgtgccttatcgcttagtggtcctggagtacggggccacaatgcattcg
ccagactatttagccatcaacccgatgggcaaggtgccggctattcgccacggtgagcga
gtggtcacggaggctgccgctatctgtgcttatcttgccgatgccttccccgaggcgggt
ttggcaccgccgctttcagcaagagacgactattatcgctggctattcttcgctgctggg
ccgctagaagctgctgcctcgcttaatagcttgggcttccaacctaatgcagagcagcgg
atgcgactaggttctggcgactttgcgacggtgattgaggctctggctgcggccgtcaat
ggacgccgctacatcgctggtgatgcttttagcgccgccgatgtttatgtcggttcccac
attggatggggaatgcagtttggaacccttccacgccgtcctgaattcgaacattactgg
gcggggatgcaaaaccgtcctgcacgacagcattgcgagatgttcatccagcaggcattg
gcacagtag

DBGET integrated database retrieval system