KEGG   Halomonas alkaliphila: CUU95_13540Help
Entry
CUU95_13540       CDS       T05720                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
halk  Halomonas alkaliphila
Pathway
halk00550  Peptidoglycan biosynthesis
halk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:halk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CUU95_13540
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CUU95_13540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:halk01011]
    CUU95_13540
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:halk03036]
    CUU95_13540
Enzymes [BR:halk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CUU95_13540
Peptidoglycan biosynthesis and degradation proteins [BR:halk01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CUU95_13540
Chromosome and associated proteins [BR:halk03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    CUU95_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AYF34772
UniProt: A0A386X2T4
LinkDB All DBs
Position
2989946..2991652
Genome map
AA seq 568 aa AA seqDB search
MKRESRGGISRQMPIAPPLAGGRFLFILIIVMLASAILVGRITLLQVIDRPFLQSQGDAR
TLRHEAIPAHRGMITDRNGEPLAISTPVVTLWANPQELPTDAIQRVMLAQALGMSLDDFE
SRVSRYSSREFMYLRRQMTPDAAQRILDLRTPGVYQQREYKRYYPAGEVAAQLLGVTNVD
DVGQEGLELSYQPYLAGHPGQRRVIKDRRGRLVRELGVIREAQPGGELTLAIDQRIQYMA
YRELRAAVAEHEADGGVLVMLDARTGEVLAMANLPSYNPNNRAGLDPRGLRNQALVDVFE
PGSVMKPLAMAAILESGVVDRDAIVDTSPGWMRLDQFTIRDFRNYGDLDLAGILEKSSNV
GMSRLALQLSDTAIWEKYNQLGLGQAPGTGFPGEATGSLPAPVRWSRSERATLSYGYGLS
VSAVQLASAYTALANNGVRLPPSLLRLSEPPQGSPAISPTVANDLLNILETSVAAYTGGR
RARVEGYRVGGKTGTVRKIGQQGYTTDAYRSVFAGIAPISDPRIVTVVMIDHPRAGQFYG
GAVAAPVFSSVTGNALRLLDVPPDHEVE
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaaagtcggggagggatatcccgtcaaatgcctattgcgccgccattagct
ggcggacgctttttatttattctcattattgtaatgcttgcgtcagccattttagtcggc
aggattacgctgcttcaggtaattgatcgcccgtttttacagagccagggcgatgcccgt
acgcttcgccatgaggcaatacccgcacaccgcggtatgatcactgatcgtaatggtgaa
cctctggctatttctacgcctgttgtaacactttgggcgaatcctcaagagctacctacc
gatgccattcagcgagtaatgctggcgcaagctttaggcatgtcgctcgatgactttgaa
tcccgtgtctctcgatatagcagtcgagaatttatgtaccttcgtcgtcaaatgacgccc
gatgcggcccagcgcatactggatttacgcacgcctggtgtttatcagcagcgtgaatac
aagcgttattatccagccggtgaagtggcggcgcagttgctgggtgttaccaatgtggat
gatgtggggcaagagggtctagagctctcttatcagccctacttagcggggcatcctgga
caacgccgagtcataaaagatcgacgaggtcgtttagttcgtgagctcggagttatccgt
gaagcgcaacctggcggtgagttaacgttggcgattgatcagcgtattcaatatatggcc
taccgtgaattgcgcgctgctgtcgctgagcatgaggcggacggtggagtgttagtaatg
ctcgatgcgcgcacaggggaagtgttagcaatggctaacttgccttcttacaacccgaat
aaccgcgctgggttagatccgcgaggtttacgcaaccaggcactggttgatgtgtttgaa
ccagggtctgttatgaagcctttggcaatggctgcaatactggaaagtggtgttgtagat
cgtgatgctatcgttgacacctcgcctggctggatgcgcctggatcagttcactattcga
gacttccgtaattatggcgatttagatttagcggggattctagaaaaatcttcaaacgtt
ggtatgtctcgtttagcgctacagctaagcgatacggccatttgggaaaaatacaatcag
ctaggtcttggacaagcaccgggaaccggctttcctggtgaggcgacaggcagtttgcca
gcgccagttcgctggtctcgaagtgaacgagcgacgctctcctatggttacggtctctct
gtttcagcggttcaattggccagtgcttacactgcgctagccaataatggcgtgcgtttg
ccgccctcgctgttgaggctttctgagcctcctcaggggagtcctgctatatcgcccaca
gtggccaatgatttgctgaatattttagaaacgtcggtcgccgcctataccggtggtcgc
cgagcgcgcgttgaaggctatcgtgtgggggggaaaacaggcacggtgcgtaaaataggg
cagcaaggttataccactgatgcttaccgcagtgtttttgcggggattgcgcctatttcc
gacccgcgtattgttaccgtcgttatgattgatcaccctcgcgctggccaattttatggt
ggagcagtggctgctccggtgttttctagcgttacaggtaatgccctacgtttgctggac
gtgccgcccgatcacgaggtcgagtag

DBGET integrated database retrieval system