KEGG   Halomonas alkaliphila: CUU95_13995Help
Entry
CUU95_13995       CDS       T05720                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
halk  Halomonas alkaliphila
Pathway
halk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
halk00405  Phenazine biosynthesis
halk01100  Metabolic pathways
halk01110  Biosynthesis of secondary metabolites
halk01130  Biosynthesis of antibiotics
halk01230  Biosynthesis of amino acids
halk02024  Quorum sensing
Module
halk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:halk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CUU95_13995
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CUU95_13995
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CUU95_13995
Enzymes [BR:halk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CUU95_13995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AYF34858
UniProt: A0A386X5X2
LinkDB All DBs
Position
complement(3091480..3092904)
Genome map
AA seq 474 aa AA seqDB search
MTTTTPASSGPQPFTLSRKPHYVTLAADCDFFALFQKIERQFDTCYMLESLGEDSHMARH
SIIGFDPEYTLYANGGTLTIEDRDGNANHYPSDNPYELLRSLIPQNIISRKYAGGLSGYL
GYDAMQYFEPSLSLKASDDFDTFRFGLYKDGLILDKMTGEVTYFYYDNSRYEFLQTLIDA
EDIPPGSLHITALGDTMSREEHAEAVAKVKQDIIDGKVFQCEVGFKKRFSIKGDTLALYD
QLRTINPSPQMYYVKFGEQKLIGASPELLFRLRQGEMETFPLAGTTTRGKTPQEDTQLAR
ALLNDPKEIAEHNMIVDLHRNDIGRVAQFGTVKVRSLMDIKRFSHVQHISSEIVGIIAEG
EDMFTSLASNFPAGTLTGAPKIEAMKIIDDLEIDGRGPYGGAVGQFSFNGDCTFAIPIRT
VFVNGESAYVQTCGGNVFDSNAEDEYEEIRRKFAGTRKALAPFMSADMDMESQA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgactacgcctgcttcatcaggcccgcagccttttacgctgtcgcgcaagcct
cactacgttaccctggcggcggactgtgacttttttgctttgtttcaaaaaattgaacgc
caatttgatacctgctacatgctggaatcactaggcgaagatagccatatggcgcgccac
tcgattattggctttgaccctgagtacacgctttacgccaatggcggcacattaactatt
gaagatcgtgacggtaatgcaaaccactatccaagcgataacccttatgagttgctacgc
agcttgattccgcagaatattatttctcgtaagtatgcgggtgggctaagtggttatctt
ggttatgacgctatgcaatactttgagccttcgttatcgttgaaagctagcgacgatttc
gacacgtttcgatttggcctttataaagatggtttgatcctcgacaaaatgaccggggaa
gtcacctatttttattacgacaacagtcgctacgagtttctgcaaaccttgatcgacgct
gaagatatccctccaggctcattacacatcactgcgctaggcgacaccatgagccgcgaa
gagcacgccgaagcggtggccaaggtgaagcaggacatcatcgacggtaaggttttccag
tgcgaagtcggctttaaaaagcgctttagcattaaaggcgatacgctagcgctctacgat
cagttgcgcaccattaacccgtcgccacagatgtactacgtgaaattcggcgagcaaaag
ctgattggcgcaagcccggaacttctgttcaggctccgccagggcgagatggagaccttc
ccgctggcaggcactaccactcgtggcaaaaccccgcaagaagacacgcagttagcccgc
gcgctactcaacgatcccaaagagattgccgagcacaatatgattgtggacctacaccgc
aacgatattggccgagtggcacaatttggcacggtgaaagtacgtagcctgatggacatc
aagcgctttagtcacgtgcaacatatctccagtgaaattgttggcattattgccgaaggc
gaagatatgtttacatcccttgccagcaacttccctgcgggtacgctgacgggcgcgcca
aaaatcgaagcaatgaaaattatcgatgacttggaaattgacggccgcggcccttacggc
ggagcggttggccagttctcatttaacggcgactgcaccttcgcgattccgattcgtaca
gtctttgtaaacggtgaaagcgcttacgtgcaaacttgtggcggcaacgtgtttgatagc
aacgccgaagatgaatacgaggaaatacgccgcaaatttgcaggcacccgcaaagccctt
gctccctttatgagcgcggatatggacatggagagccaagcatga

DBGET integrated database retrieval system