KEGG   Halomonas sp. 1513: BWR19_04325Help
Entry
BWR19_04325       CDS       T04761                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
halo  Halomonas sp. 1513
Pathway
halo00910  Nitrogen metabolism
halo02010  ABC transporters
Module
halo_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BWR19_04325
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BWR19_04325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:halo02000]
    BWR19_04325
Transporters [BR:halo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BWR19_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: APX94893
UniProt: A0A1P8R882
LinkDB All DBs
Position
complement(939691..940503)
Genome map
AA seq 270 aa AA seqDB search
MGGWSANLHRLRDTLIHNVLPPVIILAVLGAIWEILCSSPGAALPPPSQVISDTWELIVD
PFYDYGGNDKGMGWQILASLERVAYGYSLAVVAGISLGVLVGQSTWAMRGLDPVFQVLRT
VPPLAWLPISLAGFQDSTPSAIFVIFITAIWPIIINTSVGVRNIPEDYRNVARVLRLNGL
EYFTRIMLPAAAPYIFSGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAWNASMISDIVL
ALVYVGIVGFFLDRMVAYIGNRVTRGTAQG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcggctggtcggccaaccttcaccgccttcgcgacaccttgatccacaatgttctg
ccaccggtgatcatcctcgccgtgctcggggcaatctgggagatcctctgctcctcgcct
ggcgcagcgctgccgcctccctcccaggtgatcagcgacacctgggagctgatcgtcgac
cccttctacgactacggcggcaacgacaagggcatgggctggcagatactggccagcctc
gagcgagtcgcctacggctactcgctggccgtcgtggccggcatcagcctcggcgtgctg
gtcggccagtccacctgggccatgcgcgggctcgacccggtcttccaggtgctgcgcacc
gtcccgccgctggcctggctgccgatctcgctggccggtttccaggacagcactccctcg
gccatcttcgtgatcttcatcaccgccatctggccgatcatcatcaacacctcggtcggc
gtgcgaaacatccccgaggattaccgcaacgtggcgcgggtactgcgcctcaatggcctg
gagtacttcacccgcatcatgctgccggccgccgcgccctacatcttctccgggctgcgc
atcggcgtgggcctgtcgtggctggccatcgtcgccgccgagatgctgatcggcggcgtg
ggcatcggcttcttcatctgggatgcctggaacgcctcgatgatcagcgacatcgtgctg
gcgctggtctatgtcggcatcgtcggcttcttcctcgaccgtatggtcgcctacatcggc
aaccgcgtgacccgcggcaccgcccagggctaa

DBGET integrated database retrieval system