KEGG   Halomonas sp. 1513: BWR19_12435Help
Entry
BWR19_12435       CDS       T04761                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
halo  Halomonas sp. 1513
Pathway
halo00970  Aminoacyl-tRNA biosynthesis
halo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BWR19_12435 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:halo03029]
    BWR19_12435 (gatB)
Enzymes [BR:halo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BWR19_12435 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BWR19_12435 (gatB)
Mitochondrial biogenesis [BR:halo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BWR19_12435 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: APX95014
UniProt: A0A1P8R8L2
LinkDB All DBs
Position
2741717..2743168
Genome map
AA seq 483 aa AA seqDB search
MQWETVIGLEVHVQLATKSKIFSGASTAFGAEPNSQACAVDLGLPGVLPVLNEQAVAMAV
RFGLGINAEIPEVSVFDRKNYFYPDLPKGYQTSQMYHPIVGAGEVEISLEDGATKRIRVH
HAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSAKEAAAYLKAIHAIVTYL
GISDGNMAEGSMRCDVNVSVRPKGQEAFGTRAEVKNVNSFRFVERAIAYEVERQIELIED
GGTVVQETRLYDPEADETRSMRTKEEANDYRYFPCPDLLPVVLDRAYVDHLRSTLPELPA
EKRARFEGELGLSAYDASVLASSRAMAEYFEAVKEVCGDAKQAANWVQGELSGALNRENL
GIEQSPVAAEQLGELIARVLDDTINGKAAKQVFQALWNGEGDSADAIIDAKGLKQVTDSG
AIEAMIDQVIADSPVQVAQYRDAEPDKRGKMIGYFVGQVMKASRGTANPQQVNALLKEKL
DQA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaaaccgtgatcgggctggaagtccacgtccagctcgccaccaagtcgaag
atcttctccggcgcctccaccgccttcggcgccgagcccaacagccaggcctgcgccgtc
gatctcggcctgcccggggtgctgccggtgttgaacgagcaagccgtggccatggcggtc
aggttcggcctcggcatcaacgccgagatccccgaggtctcagtgttcgaccgtaagaac
tacttctaccccgacctgcccaagggctaccagaccagccagatgtaccaccccatcgtc
ggcgccggggaggtcgagatcagcctcgaggatggcgccaccaagcgtatccgcgtgcac
catgcccacctcgaggaggacgccggcaagtcgctccacgaggacttccacggcatgacc
ggcatcgatctcaaccgtgccggcacgccgctgctggagatcgtctccgagcccgacatg
cgctcggccaaggaggctgccgcctacctcaaggcgattcatgccatcgtcacctacctg
ggcatctccgacggcaacatggccgagggctcgatgcgctgcgacgtcaacgtctcggtg
cgtcccaagggccaggaggccttcggtacccgcgccgaggtcaagaacgtcaactccttt
cgcttcgtcgaacgcgccatcgcctacgaggtggagcgccagatcgagctgatcgaggac
ggcggcacggtggtacaggagacccgcctgtacgaccccgaggccgacgagacccgcagc
atgcgcaccaaggaggaagccaacgactaccgctacttcccgtgccccgacctgctgccg
gtggtgctcgaccgcgcctacgtcgaccatctcagaagcaccctgccggagctgcccgcc
gagaagcgcgcgcgtttcgagggcgagctgggcctctccgcctacgacgccagcgtgctg
gcctcgagccgcgccatggccgagtatttcgaggcggtcaaggaggtctgcggcgatgcc
aagcaggccgccaactgggtgcagggcgaactgtccggcgcgctcaaccgtgaaaatctc
ggcatcgagcagagcccggtggcggccgaacagctcggcgagctgatcgcgcgggtgctc
gacgacaccatcaacggcaaggccgccaagcaggtcttccaggcgctgtggaacggcgag
ggcgacagcgccgacgccatcattgacgccaagggcctcaaacaggtcaccgacagcggc
gccatcgaggcgatgatcgaccaggtcatcgccgacagcccggtgcaggtcgcccagtac
cgcgacgccgaaccggacaagcgcggcaagatgatcggctacttcgttggccaggtgatg
aaggcctcgcggggcaccgccaacccccagcaggtcaacgccctactaaaagaaaaactg
gatcaggcgtga

DBGET integrated database retrieval system