KEGG   Halomonas sp. 1513: BWR19_14210Help
Entry
BWR19_14210       CDS       T04761                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
halo  Halomonas sp. 1513
Pathway
halo00020  Citrate cycle (TCA cycle)
halo00190  Oxidative phosphorylation
halo00650  Butanoate metabolism
halo01100  Metabolic pathways
halo01110  Biosynthesis of secondary metabolites
halo01120  Microbial metabolism in diverse environments
halo01130  Biosynthesis of antibiotics
halo01200  Carbon metabolism
Module
halo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
halo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
halo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWR19_14210 (sdhB)
   00650 Butanoate metabolism
    BWR19_14210 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BWR19_14210 (sdhB)
Enzymes [BR:halo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BWR19_14210 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BWR19_14210 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: APX93994
UniProt: A0A1P8R5R6
LinkDB All DBs
Position
complement(3131381..3132091)
Genome map
AA seq 236 aa AA seqDB search
MSTLQVSVYRYNPETDSAPYMQEFQVDTKGRDLMVLDVLHLTKEQDSSMAYRRSCREGVC
GSDGMNMNGKNGLACITPLSEVVKHNKLVLRPLPGLPVIRDLVVDMGIFYKQYERIQPYL
QNDTPAPAIERLQSPEDRDKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQSYRFL
ADSRDEATQARLAELEDPFSVFRCRGIMNCVSVCPKGLNPTRAIGKIREMLLANAT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcttcaggtatccgtataccgctacaacccggaaaccgactccgcaccctat
atgcaggagttccaggtcgacaccaagggtcgcgacctgatggtgctcgacgtgctgcac
ctgaccaaggagcaggacagctccatggcctaccgccgcagctgccgcgaaggggtttgc
ggctccgacggcatgaacatgaacggcaagaacggcctggcttgcatcacgccgctctcc
gaggtggtcaagcacaacaagctggtgctgcgtccgctgcccggcctgccggtgatccgc
gacctggtggtcgacatggggatcttctacaagcagtacgagcgcattcagccgtacctg
cagaacgacaccccggccccggccatcgagcggctgcagtcgccggaagatcgcgacaag
ctggatgggctctacgagtgcatcctgtgcgcctgctgctcgacctcgtgcccgtcgttc
tggtggaacccggacaagttcgtggggcccgctggcctgctacagtcctaccgcttcctc
gccgattcccgcgacgaggcgacccaggcgcgcctggccgagctcgaggacccgttcagc
gtgttccgctgccgcggcatcatgaactgcgtgtcggtatgccccaagggcctcaatcca
acccgggcgatcggcaagattcgcgagatgctgctggccaatgccacttaa

DBGET integrated database retrieval system