KEGG   Halomonas sp. 1513: BWR19_14215Help
Entry
BWR19_14215       CDS       T04761                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
halo  Halomonas sp. 1513
Pathway
halo00020  Citrate cycle (TCA cycle)
halo00190  Oxidative phosphorylation
halo00650  Butanoate metabolism
halo01100  Metabolic pathways
halo01110  Biosynthesis of secondary metabolites
halo01120  Microbial metabolism in diverse environments
halo01130  Biosynthesis of antibiotics
halo01200  Carbon metabolism
Module
halo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
halo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
halo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWR19_14215
   00650 Butanoate metabolism
    BWR19_14215
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BWR19_14215
Enzymes [BR:halo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BWR19_14215
    1.3.5.4  fumarate reductase (quinol)
     BWR19_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA FAD_binding_3 HI0933_like Pyr_redox_3 NAD_binding_8 MCD_N SPESP1 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: APX93995
UniProt: A0A1P8R5Y9
LinkDB All DBs
Position
complement(3132102..3133874)
Genome map
AA seq 590 aa AA seqDB search
MSNMRSLSFDAIIIGGGGSGLRAALELAKSGKKTAVLSKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGGDYIADQDAAEYMCSEGPKAVFELEHMGLPFSRFDNGRIYQRP
FGGQSKNFGEGGQAARTCAAADRTGHALLHTLYQNNLKNNTTFLNEWYAVDLVKNANGDV
VGCIALDIETGEVVHVKSKATVLATGGAGRIYASTTNALINTGDGIGMALRAGFPMQDME
MWQFHPTGIYGAGTLVTEGCRGEGGYLVNKDGERFMERYAPNAKDLAGRDVVARSMVMEI
LEGRGCGEKGDHVFLKLDHLGEEVLGKRLPGIVELSKTFAHADPAKEPIPVVPTCHYMMG
GIPTNVHGQAIMQDADGNDQIVNGLFACGEAACVSVHGANRLGGNSLLDLVVFGRAAGMF
IEGALNEGIDYLDATQSDVDAAMKRMSRWNESSGGESVPELKAELQDIMQNAFGVFRQED
NMQEGVKKLADLRERIANAHLGDKSNAFNTARVEALELDNLMEVAEATAISALERKESRG
AHSRYDYPDRDDVNWLKHSLYFPADKRLGKRDVNFTPKTVDTFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatgcgtagcctgtccttcgacgccatcatcatcggcgggggtggctccggc
ctgcgtgccgcgctcgagctggccaagtccggcaagaagaccgcggtgctctccaaggtc
ttcccgacccgctcgcacaccgtctctgcccagggcggtatcacctgtgccatcgcctcg
gcggaccccaacgacgactggcgctggcacatgtatgacaccgtcaagggcggcgactat
atcgccgaccaggacgccgccgagtacatgtgctccgagggccccaaggcggtcttcgag
ctcgagcacatgggcctgccgttctcgcgtttcgacaacggccgcatctatcagcggccg
ttcggtggccagtccaagaacttcggcgagggcggccaggcggcgcgcacctgtgccgcg
gccgaccgcaccggccacgccctgctgcacaccctttaccagaacaacctgaagaacaat
accaccttcctcaacgagtggtatgcggtggatctggtcaagaacgccaacggcgacgtg
gtgggctgcatcgcgctggacatcgagaccggcgaagtggtgcacgtcaagtccaaggcc
acggtgctggccaccggtggtgccgggcgcatctacgcttccaccaccaacgccctgatc
aataccggtgacggcatcggcatggcgctgcgcgccggcttcccgatgcaggacatggag
atgtggcagttccaccccaccggcatctacggcgccggcaccttggtcaccgagggctgc
cgcggtgagggcggctatctggtcaacaaggacggcgagcgtttcatggagcgctatgcg
cccaacgccaaggaccttgccggccgcgacgtggtagcgcgctcgatggtcatggagatc
ctcgagggccgcggctgcggtgagaagggcgaccacgtcttcctcaagctcgatcatctc
ggcgaagaggtgctgggcaagcgcctgccgggcattgtcgaactgtccaagacctttgcc
cacgccgatccggccaaggagccgatcccggtggtgccgacctgccactacatgatgggc
gggatccccaccaacgtgcacggtcaggcgatcatgcaggacgccgacggcaacgaccag
atcgtcaacggcctgttcgcctgtggcgaggcggcctgcgtgtcggtgcacggcgccaac
cgcctgggcggcaactcgctgctcgacctggtggtgttcggccgcgcggcggggatgttc
atcgagggcgcgctcaacgagggcatcgactaccttgacgctacgcaatccgacgtcgat
gcggcgatgaagcgcatgagccgctggaacgagtcgagcggcggcgagagcgtgccggag
ctcaaggccgaactgcaggacatcatgcagaacgccttcggcgtgttccgccaggaggac
aacatgcaggagggcgtcaagaagctcgccgacctgcgcgagcggatcgccaatgcccac
ctgggcgacaagtcgaacgccttcaacaccgcgcgtgtcgaagcgctggagctcgacaac
ctgatggaagtggccgaggccaccgcgatctcggcgctggagcgcaaggagagccgcggt
gcgcactcccgctatgactatccggatcgggacgacgtcaactggctgaagcactcgctc
tatttcccggccgacaagcggcttggcaagcgcgacgtcaacttcacgccgaagaccgtc
gataccttcgagccgaaagtccgtacatattaa

DBGET integrated database retrieval system