KEGG   Halomonas sp. 1513: BWR19_16865Help
Entry
BWR19_16865       CDS       T04761                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
halo  Halomonas sp. 1513
Pathway
halo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWR19_16865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:halo01002]
    BWR19_16865
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:halo01011]
    BWR19_16865
Enzymes [BR:halo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BWR19_16865
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BWR19_16865
Peptidases and inhibitors [BR:halo01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   BWR19_16865
Peptidoglycan biosynthesis and degradation proteins [BR:halo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BWR19_16865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: APX94471
UniProt: A0A1P8R7B0
LinkDB All DBs
Position
complement(3698141..3699601)
Genome map
AA seq 486 aa AA seqDB search
MCRPLARLLLPLTLCLLPSLAQAAGFANLERMTEQGFLISAEARLLDGGGELLGAIEPQR
QLSPASVSKIYLAAAALERWGPQHRFTSELKSTAEIDADGILQGDLIFEGGGDPALVSEE
LWKLVQLLRQRGVRGINGQLVVSQWRFGPVACVTRDRCDTVERSANTYSALLSSAGVNYG
SWCMNVHPGASVGDSARVVSCDTVEPVIGVNNQVTTVAAGNATELNAERVTDAGGDTMIL
RGQIAANASPREVYRASSDPAGQTAQTLLALLTQAGVEVAGDAAGVPYVTSTVEPNGAAR
RLAAVDGKPLQELVLRTMNYSNNFMADVLNLGLVPTPQTSLEEAAQALEAYAAAIPGHGP
VILHSGSGLTTTNRTSAAGVNALLEYAYHRPTLFPHLVASMQTPTNGPSRFIRRGSERFQ
NNVMLKTGTLNQPFAVRSVGGYFRTDSGRWGVFTALVNGTSTTPWLNWTQVLDPLADDLD
AMIRAH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgtccgctagccaggctgctgttgccgttgactctttgcctgctgccatcgctc
gctcaggcggcggggtttgccaacctcgaacggatgaccgaacagggcttcctgatcagc
gccgaggcgcggctgctggacggcggcggcgagctgctgggcgcgatcgagccgcagcgt
cagctgtcaccggcctcggtgtcgaagatctacctggcggcggcggcactggagcgctgg
gggccgcagcaccgcttcaccagcgagttgaagagtaccgccgagatcgacgccgacggc
atcctgcagggcgacctgattttcgagggcggcggcgacccggcgctggtctccgaagag
ctgtggaagctggtgcagctgctacgccaacgcggcgtgcgaggcatcaacggtcagctg
gtggtcagtcagtggcgcttcggcccggtggcatgcgtcacgcgtgaccgctgcgatacc
gtcgagcgctcggccaacacctacagcgcgctgctcagctcggcgggggtcaactacggc
agctggtgcatgaacgtgcatcccggtgccagcgtcggtgactcggccagggtggtgagc
tgcgataccgtggagccggtgattggcgtcaacaatcaggtcaccaccgtggccgccggc
aacgccaccgagctcaacgccgagcgcgtcaccgatgccggcggcgataccatgatcctg
cgcggccagatcgccgccaacgcctcgccgcgtgaagtctaccgggccagctccgacccg
gccgggcagaccgcccagacgctgctggcgctgctcacccaggccggcgtcgaggtcgcg
ggagacgcggccggcgtaccctacgtgacctccacggtggagcccaacggcgccgcgcgt
cggctcgcggcggtagacggcaaaccgctgcaggagcttgtgctgcggaccatgaactac
tccaacaacttcatggccgacgtgctcaacctggggctggtgccgacgccgcagacctcg
ctggaagaggccgcccaggcgctcgaggcctacgccgcggcgattcccggccatgggccg
gtcatcctgcacagtggcagcggcctgaccactaccaaccgcacctcggcggcgggcgtc
aatgcgctgctcgaatatgcctaccatcggccaacgctgtttccgcacctagtggccagc
atgcagaccccgaccaacggcccgtcgcgcttcatccgccgcggcagcgagcgcttccag
aacaacgtgatgctcaagaccggcaccctcaatcagcctttcgcggtgcgctcggtgggc
ggctattttcgcaccgacagcggccgctggggcgtcttcaccgcgctggtcaacggcacc
tcgaccaccccctggctgaactggacccaggtgctcgacccgctggccgacgatctcgat
gccatgattcgcgcccactga

DBGET integrated database retrieval system