KEGG   Halomonas sp. 1513: BWR19_17300Help
Entry
BWR19_17300       CDS       T04761                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
halo  Halomonas sp. 1513
Pathway
halo00730  Thiamine metabolism
halo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BWR19_17300
Enzymes [BR:halo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     BWR19_17300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO HI0933_like FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox FAD_oxidored FAD_binding_3 Pyr_redox_3 Amino_oxidase ApbA 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: APX94541
UniProt: A0A1P8R7H7
LinkDB All DBs
Position
complement(3796752..3797852)
Genome map
AA seq 366 aa AA seqDB search
MSDFLVIGGGVIGMMTTLQLADAGHEVTLLERGACGRESSWAGGGIVSPLYPWRYTAPIS
RLSTWSEGYYPELALRLLEETGIDPEYRQKGLLYLRVEDEPRALGWARAVGKPLERVAAD
FLYAKEPAAVPGCDGALWMPTLGSIRNPRLVKALRARLAAMPKVRIEEGCEVTGLSRAAG
RITAVDAGAERFTAGEVVVCGGAWAAELLGSLGVGLPVRPVKGQMILFKAPTGLLQRVVL
MDGRYVIPRADGRVLAGSTLEEAGFDKGTDRAARESLWESATRIVPALAECEVEHHWAGL
RPGSPDGTPFIGRVPGLDNLSVNAGHYRNGLVLAPASTRLLVDQLLGREAILDPSPYRLE
GRLISA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatttcctagtcataggcggcggggtcatcggcatgatgaccacgctgcagttg
gccgacgccggccacgaggtgaccctgctcgagcgcggtgcgtgcggccgcgagtcctcc
tgggccggtggcggtatcgtttcgccactctatccctggcgctatacggcgccgatctcg
cgtctctcgacctggtcggaaggctactaccccgagcttgcgctgcggttgctggaagaa
acgggtatcgatccggagtatcgccagaaggggctgctgtacctgcgcgtcgaggatgaa
ccgcgggcgttgggctgggcgcgggcggtgggcaagccgctggagcgggtggcggccgac
tttctctacgccaaggagccggcggcggtgccgggctgcgatggcgcgctgtggatgccg
accctgggcagcattcgcaacccgcggctggtcaaggcgctgcgcgcacgcctggccgcg
atgcccaaggtgcgcatcgaggagggctgcgaggtgaccggcctttcacgcgcggcaggg
cgaatcacggcggtggatgccggcgccgagcgcttcactgccggggaggtggtggtctgc
ggtggcgcctgggccgccgagctgctcgggtcactcggcgtgggcctgccggtgcgcccg
gtcaagggccagatgatcctgttcaaggcgccgacggggctgctgcaacgagtggtactg
atggacggccgctacgtgattccccgcgccgacggtcgcgtgctggccggctcgaccttg
gaagaggcgggcttcgacaagggcaccgaccgcgcggccagggagtcgctgtgggagagt
gccacgcgcatcgtgccggcgctggccgagtgcgaggtggagcatcactgggccgggctg
cggccgggctcgccggatggcacgccctttatcggccgcgtgccggggctcgacaacctc
agcgtcaatgccggccactaccgtaatggcctggtgctggcgccggcctcgacgcgcctg
ctggtagatcagctgctggggcgcgaagcgatcctcgacccaagcccctaccggctggag
gggcggctgatcagcgcctag

DBGET integrated database retrieval system