KEGG   Halorubrum sp. PV6: DOS48_08565
Entry
DOS48_08565       CDS       T05770                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase 2 family protein
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
halp  Halorubrum sp. PV6
Pathway
halp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:halp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DOS48_08565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:halp03400]
    DOS48_08565
Enzymes [BR:halp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     DOS48_08565
DNA repair and recombination proteins [BR:halp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DOS48_08565
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-ProteinID: AZQ14877
UniProt: A0A3Q9EDA5
LinkDB
Position
complement(1750022..1750618)
AA seq 198 aa
MNERVAATLRDDPTMARLIDRHGPLTVEPAADEFARLCTSIVNQQLSTASAAAIHERFLD
TLGGDPTPDRVLAADTDALRDAGLSGTKVEYLREAAAAFRDGDRDLTREGLADASDEAAV
AALTDIRGVGEWTAQMYCIFALGREDVLPLGDLAVRKGIEQVYNDGEPLSRSEMRDIGVA
WRPYRSYGTRYIWAAYES
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaacgagcgagtcgcggcgactctccgagacgatccgacgatggcccggctgatcgac
cgacacggtccgctcacggtcgagccggccgcagacgagttcgcgcggctctgtacctcc
atcgtgaaccagcagctctcgaccgcctccgcggcggcgatccacgagcgatttctcgac
acgcttggcggcgacccgacccctgaccgcgtgctcgccgccgacaccgacgccctccgc
gacgccggcctcagcggcacgaaagtcgagtacctccgcgaggcagccgcggcgttccga
gacggcgaccgcgatctgactcgcgagggcctcgcggacgcgagcgacgaggcggccgtg
gcggcgctcaccgacattcgcggcgtcggcgagtggaccgcacagatgtactgcatcttc
gcgctgggtcgcgaggacgtgcttccgcttggggatctggccgtgcggaagggcatcgag
caggtgtacaacgacggggagccgctcagccgctcggagatgcgcgatatcggcgtggcg
tggcgaccgtaccggagctacgggacgcggtacatctgggccgcttacgagtcgtaa

DBGET integrated database retrieval system