KEGG   Halocella sp. SP3-1: D7D81_00760Help
Entry
D7D81_00760       CDS       T05769                                 

Definition
(GenBank) glycosyltransferase
Organism
hals  Halocella sp. SP3-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glycos_transf_1 Glyco_trans_1_4 Glyco_tranf_2_5 Glyco_trans_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_trans_1_2 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AZO93233
UniProt: A0A3S9GWA0
LinkDB All DBs
Position
complement(171529..174561)
Genome map
AA seq 1010 aa AA seqDB search
MSSEELSGGNSMQVIFIISDQDNIMIIKSLFEIARWLKENKDIKVLMYIPEIKNYNILPK
ASIEIHWLTNRFSASEIPEADIILSTQLDLLRQLSLLSRGELVYLNNTGKKQEISAGIRV
IGFNSLKPGIPDRLYLQEDKKRDKIVVAGDSLDKKGLSKIISALEIAASSITHDGVVILN
SPEKYFFDTEINYYYEDIDHKPIIGLLSRGFYLIYLGRNEFPLLPLWSMAAGVLTISINL
SEREWGYPLELSKYTPLELALIIIRSYKMGQWRNSLLVEAERLVKEYKLNKVGEDWAGYF
EDVLQGVNPAADSKEVDKQQKYKSQMNYSKRLTKNPVDLIIVNYNTLDYLKKCLVSIKSK
TREDYNIIVVDNGSSDGSIEYLKKQEDILLIENKENLGYARACNQGIIAGSAEYIVLLNS
DIEVTTCWLGKMIKVAAGDDVAVVGPKLINQEGLIVGAGVDSLRDDFKPRGWKELDRPGV
YDQQEDLLSVGGACYLIKRDLLPVLGLFDEGYFFYFEELDYSLRAREKGYRVVYCPQARV
IHHHEGSLKSGNKNNKLKRDRYFSVGRKRFKSKWGEVIAGSEKRHQKRKIMVAGLIPWDF
RQQRPQHLMRNLTQLGYEILYLNPVCGSGETIEVEENIHIYSPHGYGTVLYNLEHNKRDR
LGQEINSLLRELNFENCIVLLNAPYWTPLLQFWEYSLLIYDCIDNYTEFEDLVHHEAIIK
KAEQKLLNLADLVLTSSTGLYEEKKAVNDNTYLVPNGVDTRYFNYNYKPAIKPDDIPDSR
KIIGYYGAISSWFDVELVKSLAASLPEVAVVLIGEVSTDISHLSNLSNVSLLGEKPYHLL
ADYLYYFDLAIIPFIKNNLTLMSDPVKLYEYLAAGKPVLTTELPEVKKFEKLITIAKDKT
DFISQAADLINNDVSEDNREDRHKLIKNKTWLRRAEKINSLIYFAYYDLYPQEEELEDII
EGDKGSLSVELPEDELLSDNLVKIEEPVIKKNSKNWLSMLKEWLTGESSE
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgaagaattaagtggggggaatagtatgcaagttatttttataatttctgat
caagataatattatgataataaagtcgctctttgaaattgccaggtggttaaaggaaaat
aaagatatcaaggttttaatgtatattcctgaaataaagaattataatatcttgcctaaa
gctagtattgagatacactggttaactaatagattttctgccagtgagattccagaagca
gatattattttaagtacacaactggatttattaagacaattaagtttattatccaggggg
gaactggtttatttaaataataccgggaaaaagcaggaaatttctgctggtatcagggtg
attggttttaatagtttaaaaccggggatacctgatagactttatcttcaagaagataaa
aaaagggataaaatagtagtggctggtgatagtttagataaaaaaggtttatcaaaaata
atttctgcccttgagattgcagcttcttcaatcactcatgatggggttgtaatccttaat
tcaccagaaaagtatttttttgatacagaaataaattattattatgaagatattgatcat
aaaccgattataggcttactcagcaggggattttatttaatatatcttggaaggaatgaa
tttccactccttcccctctggtcaatggcagcaggtgtactgacaatcagcattaatttg
tctgaaagggaatggggttatccccttgaattaagtaaatatacccctcttgaactggcc
ttaattattattaggtcatataagatgggtcagtggagaaatagtctcttagtagaagct
gagagattggttaaagagtataagttaaataaggttggagaggattgggcagggtatttt
gaagatgtcttacagggagtaaaccctgccgctgactccaaagaagtagataagcaacag
aaatataaatctcagatgaattattcaaaaagattgactaagaatccagttgatttgatc
atagtcaattataatactttagattacctcaagaagtgtctggtaagtattaagagtaag
accagagaagattataatattattgtagttgataatggtagtagtgacggcagcatagag
tatcttaaaaaacaggaagatattttattaatagagaataaagaaaatttaggttatgcc
cgggcttgtaatcaaggtattattgccggaagtgctgaatatatagttttattaaatagt
gatattgaggtaacaacatgttggttgggaaagatgattaaggtagccgccggggatgat
gttgctgtagtaggtccgaagttgattaatcaagaagggctaattgtaggtgctggtgtt
gatagtttaagggatgattttaaaccaaggggttggaaggagctggatagaccaggtgta
tatgaccagcaggaagatttattaagtgtaggaggtgcctgctatcttattaaaagggat
cttttgccagttctggggctttttgatgagggttatttcttttattttgaggaattggac
tattcattacgggctagggaaaaaggctaccgggtggtttactgtcctcaggcaagggtt
attcatcaccatgaaggcagtttaaagtccggcaataaaaataacaaattaaaaagggat
agatattttagtgtaggtagaaagagatttaagagtaaatggggagaagttatagctggc
agtgaaaagcgtcatcagaaacgaaaaattatggtcgccggtctaataccgtgggatttt
aggcagcagcgtcctcagcatttgatgagaaacctgacacagcttggttacgaaatactc
tatcttaatccagtatgtgggagtggagaaactattgaggtggaagagaatatacatatt
tattctccacatggttatggaacagtactctataatctcgaacataataaaagggatagg
ttaggacaggaaattaattctctgttaagggaattgaattttgaaaactgtattgtttta
cttaatgccccttactggacccctttattacagttctgggaatatagtttattaatctat
gattgtatagataactatacggagtttgaagacctggttcatcatgaggctataataaaa
aaagctgagcagaaactcttaaatctagctgacttggttttaacgtcatctacaggtcta
tatgaagaaaaaaaagcagttaatgataatacttatttggtccctaatggtgtagatacc
agatattttaactataattataaaccagctattaaacctgatgatataccagatagtagg
aaaattataggttattatggtgcaatatcgtcatggtttgatgtggagcttgttaaaagt
cttgctgcttctctgccagaagtagctgtagttttgattggggaggtaagtacagatatt
agtcatttaagcaatctttcaaatgtaagtttgctgggcgaaaaaccctaccatcttctg
gcagattacctatattattttgatttagcgatcataccctttattaaaaacaatttaact
cttatgagtgatcctgtaaaactgtatgaatatcttgctgctggtaagcctgtactgact
accgaattaccagaggtaaagaagtttgaaaagctgattactatagctaaagataaaacg
gactttattagtcaggcggcagatttgataaataatgatgttagtgaggacaacagagag
gatagacataagcttattaaaaataaaacatggctgaggagggcagaaaaaataaatagt
ctaatatattttgcctattatgacttatacccgcaggaagaggaactggaggatataatt
gaaggagataaaggtagtctatcagttgagctgcctgaagatgagctgttatcagataat
ctggttaaaatagaagagccggttattaagaagaatagtaaaaattggctgagtatgtta
aaggagtggttaactggtgaaagcagtgaataa

DBGET integrated database retrieval system