KEGG   Halocella sp. SP3-1: D7D81_01015Help
Entry
D7D81_01015       CDS       T05769                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
hals  Halocella sp. SP3-1
Pathway
hals02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hals00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    D7D81_01015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hals02000]
    D7D81_01015
Transporters [BR:hals02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    D7D81_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_1 SBP_bac_8 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AZO93282
UniProt: A0A3Q9B5G9
LinkDB All DBs
Position
221692..222717
Genome map
AA seq 341 aa AA seqDB search
MFKKIICISLIITGLFTARGITADNKLVIYTALQEREAQVYAQAFENYTGIKVKTIRKST
GVLLNLLRRGKNYRPGVDVLLGGPAEFYYLANKEGLFEQYNSSLTKKIPQEYRDLENHWW
GIYLGSIGFAVNPVALQKLNLKPPMTWLDLASPEYKGLITIPNPVSSGTGYTILSTIIQL
YGLDEGIQLLKKINSNVQNYTNSGAMASKLTGINASTIGISFSHDIQKFKQQGYPINLIL
PTDGTGYEIGGIAIVKDTKHLKQAKQFVDFMLSTRGQKLYSAMSEYRLPTNIEAPIPDGA
ISFDNINVINYNLEWSSLQQENIANLWLNEVYLRGKTNENN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattatttgtatctcacttattatcacaggcctctttactgcaagagga
ataactgccgacaataaactagttatctatacagcactgcaagaaagagaagcccaggtt
tatgctcaggcatttgaaaactataccggtataaaagttaaaacaattagaaaatcgacc
ggggtactattaaacctacttagacggggaaaaaattaccggccaggtgtagatgtgcta
ctaggcggtccagctgaattttattatttagcaaataaggaaggtctttttgaacaatac
aattcatcattaactaagaagataccgcaagaatatagagacctggaaaaccattggtgg
ggaatctatctcggctcaattggttttgccgttaatccagttgcactgcaaaaattaaat
ttaaaaccacctatgacctggcttgacctggcttcaccggaatataaaggtctaattact
atccctaacccagtttcatcaggcactggttatacaatattatctacgataattcaattg
tacggcctggatgaagggattcaactacttaagaaaataaatagcaatgttcaaaattat
accaatagtggtgctatggccagtaaattaacgggaattaatgcttctactatcggtatc
tcctttagccatgatatccagaaattcaaacaacaaggttatcctatcaaccttattctt
cccaccgatggaactggctacgaaattggcggcatagctattgttaaagataccaaacac
cttaaacaggctaaacaatttgtcgattttatgcttagtacaaggggtcaaaaactttac
tcagctatgagtgaatatcgcttgcctactaatattgaggcccctattcctgatggtgcc
atttcctttgataatattaatgtcattaactataacctagagtggtccagtctgcagcaa
gaaaatatagctaacctctggttaaatgaagtctatcttagggggaaaacaaatgaaaac
aattaa

DBGET integrated database retrieval system