KEGG   Halocella sp. SP3-1: D7D81_03785Help
Entry
D7D81_03785       CDS       T05769                                 

Definition
(GenBank) zinc-binding dehydrogenase
Organism
hals  Halocella sp. SP3-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N Orthopox_F6 ADH_N_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AZO93783
UniProt: A0A3Q9B5P8
LinkDB All DBs
Position
800461..801507
Genome map
AA seq 348 aa AA seqDB search
MEGDVIMKAAVLTDWEKIEVKDVAKPEIDDGECLIKVSYAGVCGSDVHIYGGHHPTAQAP
VILGHEFVGIVKEIKDSSCDIRVGDRVVVEPLISCGICEACREGNWHVCKELKLLGIHSN
GGFAEYVKVSVDKVIKTSKNLTDHAAALTEPFAVGFHVNQRAGMKNGDKVLVIGAGPIGL
IVGMVAKISGASEVVFSEINLDRIKQIKSFGFENVINPKEGDEIAKANEITNNQGFDVVY
EVSGTEAGLSLAAQACRIRGTIVPVGFPNGIPKFDMLKVIFKELNIVGSRVYSFDHFRKT
VDMLEKIIKNELFDLEKLISEIYQIEDLEKAIKVMQKGKNLGKILIEC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagggagacgttataatgaaagctgcagtattaacagattgggagaaaatagaggtt
aaggatgtggccaaaccagaaattgatgatggtgaatgcttaataaaagtttcatatgcg
ggagtttgcggttctgatgtccatatatatggtggacatcatccaactgctcaagcacca
gttattttaggacatgagttcgttggtattgttaaagaaataaaagacagttcctgtgat
attagagtaggtgacagagtagttgttgaacctttgattagttgtggtatttgtgaagcc
tgtagggaaggcaactggcatgtatgcaaagaattaaaattactagggatacatagtaat
gggggatttgccgaatatgttaaagtatcagtagataaggtaataaaaacaagcaaaaat
ttaacggatcatgctgctgccttaactgaaccattcgcagttggttttcatgtaaatcaa
agggctggaatgaaaaatggagataaagtattagtgattggtgctggtccaatagggttg
atagtaggaatggttgctaaaattagtggtgcttcagaagtagttttttcagaaataaat
cttgatagaatcaaacaaattaaatcttttggctttgaaaatgttattaatcctaaggaa
ggggacgaaatagcaaaagcaaatgaaataactaacaatcaaggttttgatgtggtttat
gaagtttctgggacagaagctggtttgtctttggcagcccaagcatgtaggataagggga
acgattgttcctgttggatttccaaatggtattcctaaatttgatatgttaaaagttatt
tttaaagaattaaatatagttggtagtcgtgtttatagttttgatcactttagaaaaaca
gtcgatatgttagaaaagattataaaaaacgaattatttgatttggaaaaattaattagt
gagatatatcaaatagaagatttagaaaaggccattaaagtcatgcagaaaggtaaaaat
ctaggaaaaatattaatagaatgttaa

DBGET integrated database retrieval system