KEGG   Halocella sp. SP3-1: D7D81_06850Help
Entry
D7D81_06850       CDS       T05769                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
hals  Halocella sp. SP3-1
Brite
KEGG Orthology (KO) [BR:hals00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hals02000]
    D7D81_06850
Transporters [BR:hals02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    D7D81_06850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd NMT1_3 PAGK PPO1_DWL
Motif
Other DBs
NCBI-ProteinID: AZO94338
UniProt: A0A3Q9B7S2
LinkDB All DBs
Position
1438412..1439188
Genome map
AA seq 258 aa AA seqDB search
MKNKKIVLLSLLLLLVITMFSSFTIYAASLTEVIEKGEISFAMSGGYPPFNFYNEHNELV
GYDVDVAAEIASRLGVEFEPVTTAWDGIIEGLRAGRYDGILGSMAITPSRLEVVDFSIPY
YYSGAQLIVADDSLIETPADIDGKTVGVTTGTTFAEDARKLGAKINLYEDDNQTLMELMN
GRIDGVISDRMVGVGFKNKGYAVKMAGELLRTEDIAVAFRKEDSTLLVEVNKILLEMHKD
GTLAGIGDKWFGMDITLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaaaagatagtattgttaagtttattactgctgttagttattaccatgttt
tcttcttttactatttatgcagcctcattaacagaggttatagaaaaaggggagattagt
tttgcgatgagtgggggttacccaccatttaatttttataatgagcataatgaattagtg
ggttatgatgttgatgtggctgctgagattgccagtagactgggtgtagagtttgaacct
gtcacaacagcctgggatggaattattgaagggctacgagctggtaggtatgatggtatt
ttagggagtatggcaatcacaccgtctagactggaggtagttgattttagtattccttac
tactattctggtgcccagcttattgttgctgatgattctttaattgaaactccggcagat
attgatggtaagacagtgggggtaacaaccggtacaacctttgcggaagatgcacgtaaa
cttggtgctaagattaatctttatgaggatgataaccagacactaatggaacttatgaat
ggtaggattgatggggttatcagtgaccggatggtaggtgttggttttaagaataaaggt
tatgctgttaaaatggcaggggaacttttgagaactgaggatatagcggttgcttttcgt
aaagaagacagcactttactggttgaagtaaataagattttactagagatgcataaagac
ggtaccttggctgggattggtgataaatggtttggtatggatattacattaaaataa

DBGET integrated database retrieval system