KEGG   Halocella sp. SP3-1: D7D81_15535Help
Entry
D7D81_15535       CDS       T05769                                 

Definition
(GenBank) flagellar assembly protein FliW
  KO
K13626  flagellar assembly factor FliW
Organism
hals  Halocella sp. SP3-1
Brite
KEGG Orthology (KO) [BR:hals00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:hals02035]
    D7D81_15535
Bacterial motility proteins [BR:hals02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    D7D81_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliW
Motif
Other DBs
NCBI-ProteinID: AZO95887
UniProt: A0A3S9H3T7
LinkDB All DBs
Position
complement(3247759..3248217)
Genome map
AA seq 152 aa AA seqDB search
MKLKSKICCSIRSNSEETISFFDGIPGFNDQKKFVFLCSKDKGPFIVMQSVEEDNLAFIT
INPWKVLGDYQFEISDLVKERLAIKSLEDILVLAICNIRGRLVNMTVNLAAPLVINYKKR
LGKQVVLDNTDYQVRHPVFSVQSKLGVQKCLF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaagcaagatttgttgtagcataagaagtaatagtgaggaaacaattagc
ttttttgatggtattcccggttttaatgatcaaaaaaaatttgtatttctgtgttcaaaa
gacaaagggccttttatagttatgcagtcagttgaggaagataacctggcctttatcact
ataaatccctggaaggtattaggggattaccagtttgaaattagtgatctggtcaaagaa
agattagctattaagtcattagaagacatcctggtgctggctatctgtaatattaggggg
agactagtgaatatgacagtgaatttagctgccccgcttgtcataaattataaaaaaaga
cttgggaaacaagttgttttagataatacagattatcaagtaaggcatcctgttttttca
gtccagtctaaactgggggttcaaaagtgcttgttttaa

DBGET integrated database retrieval system