KEGG   Halocella sp. SP3-1: D7D81_16320Help
Entry
D7D81_16320       CDS       T05769                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hals  Halocella sp. SP3-1
Pathway
hals00030  Pentose phosphate pathway
hals01100  Metabolic pathways
hals01120  Microbial metabolism in diverse environments
hals01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D7D81_16320
Enzymes [BR:hals01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     D7D81_16320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AZO96027
UniProt: A0A3Q9B7G3
LinkDB All DBs
Position
complement(3420174..3421970)
Genome map
AA seq 598 aa AA seqDB search
MYGYNGKILRVNLSNKTVKNEELDIDLAQKFIGGRGLGTKMLMDEVDPKVDALSPENKLI
FITGPLTGTSTPTGGRYMVVTKAPLTGTVASSNSGGYWGAELKFAGYDAIIFEGKADSPV
YLNIVDDKVEIKDASHLWGKVVSETTHVLEKEHGEKVKVATIGPAGENLSKIAAIMNDLG
RAAGRSGVGAVMGSKNLKAIVVKGNNKVDIAEPDKLKEVFSVCMKKIKENGVTGQGLPAY
GTAVLVNIINENGVFPTNNFQYSTFDQAEEISGETLADKYLKKKDPCFRCPIACGRYCEV
DDIEGAGPEYETVWAFGSDCGVSNLGDIIKANYWCNEIGIDTISAGSTIAAAMELYDKGY
IKEEELAGAPELAWGNNEAIIEWTKKMADTEGLGAKMAQGSYRLCEMYGVPEISMTVKKQ
ELPAYDPRGIQGHGVQYATSNRGGCHVRGYMISPEILGLPEKLDRFTLEGKPTWAKIFQD
FTAAIDSSGLCLFTSFAMGAEDYAALVNAVCGTSLTGDDFIQAGERIWNLEKMFNLEAGI
DPSEDTLPKRLLNEPIKDGPSKGWVHKLDELLPQYYEVRGWGTDGIPTSEKLKELGLA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatataatggtaagattttaagagtcaatttgagcaacaaaacagtaaaaaat
gaagaactggacattgacctggcacagaaatttattggtggtagaggattaggtaccaaa
atgctgatggatgaggttgaccctaaagttgatgccttaagtccagagaataaattgatt
tttattactggcccgttaacaggaaccagtacaccaactggtggaaggtatatggtagta
actaaagcgcctctaacaggtactgtagctagttctaactcaggtggatactggggtgct
gaacttaaatttgccggttatgatgctattatttttgaaggaaaggctgattcacctgtc
tatcttaatattgttgatgataaggttgaaattaaagatgcctctcatctctggggaaaa
gttgtttccgagactacccatgttttagaaaaagaacatggagaaaaagtaaaagttgcg
actattggacctgctggtgaaaatctttccaaaatagcagctattatgaatgacctgggt
agagctgcaggacgttctggtgttggtgctgtaatgggctcaaaaaatcttaaagctata
gtagttaaaggaaataataaagttgatatagcagagcctgacaaacttaaagaagttttc
tctgtctgtatgaaaaaaataaaagaaaatggagttaccggacagggactaccagcttat
ggtacagctgtgttggttaatattatcaatgagaatggtgtatttccaaccaataatttc
cagtatagtacttttgatcaggctgaagaaatcagtggcgagactttagcagataaatat
ctaaaaaagaaagatccttgttttagatgcccaatagcttgtggtaggtattgtgaagtt
gatgatattgaaggtgctggacctgagtatgaaactgtctgggcttttggctctgattgt
ggagtatctaaccttggtgatattattaaagccaattattggtgtaatgaaataggaatc
gataccatttctgctggttctacaattgctgcagctatggagttatatgataaaggatat
attaaagaagaagaattagctggagcacctgaacttgcctggggaaataatgaagcgatt
atagaatggacaaagaagatggctgatactgagggactgggagctaagatggctcaaggg
tcttacagactttgtgaaatgtatggtgttccagaaatttcaatgacagttaaaaaacag
gaactgcctgcttatgatcctaggggtatacagggccatggggtacaatatgctacttct
aatagaggtggctgccatgttagaggttatatgatttcccctgagatcttaggacttcct
gaaaaacttgatagatttactctggaaggaaaaccaacctgggctaaaatatttcaggat
tttactgcagctattgattcatctggactgtgtctctttacttcttttgccatgggggca
gaagattatgctgctctggtcaatgctgtgtgtggtactagtttgactggagatgatttt
atacaggctggtgaaaggatatggaaccttgaaaaaatgtttaacctggaagcaggaatt
gacccttcagaggatacattacctaagagattactaaatgaacccattaaagatggccct
tccaagggatgggtacacaaattagatgaactccttccccaatactatgaagtcaggggc
tggggcactgatggaatacctacttcagagaagcttaaggaattagggttagcatag

DBGET integrated database retrieval system