KEGG   Halomicrobium mukohataei JP60: E5139_04580Help
Entry
E5139_04580       CDS       T05947                                 

Definition
(GenBank) Gfo/Idh/MocA family oxidoreductase
  KO
K14273  D-xylose 1-dehydrogenase (NADP+) [EC:1.1.1.179]
Organism
halz  Halomicrobium mukohataei JP60
Pathway
halz00040  Pentose and glucuronate interconversions
halz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    E5139_04580
Enzymes [BR:halz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.179  D-xylose 1-dehydrogenase (NADP+)
     E5139_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C
Motif
Other DBs
NCBI-ProteinID: QCD64948
UniProt: A0A4D6K9G5
LinkDB All DBs
Position
complement(912658..913641)
Genome map
AA seq 327 aa AA seqDB search
MEFGVLSTAAIGREDVIPAIQASEHAVGAIASRDAERARSVADELDIDRSYGSYEALLAD
EGIDAVYNPLPNSLHAEWTRRAADHGLHVLCEKPLTPDAEQARALFDYCDRQGVTLMEAF
MYHFHPRTERAREIVREELGEVRHVEATFTFGMGDRTDDIRLDPALDGGSLMDIGCYAVS
AVRNVLGEPNRAFAHAADTYDTGVDSQLSGLLTYDDGVTAQITSSFDTPMTHEYRIMTAD
GWLHVPEAFDVAPDQSVSLTYQVDGQRHTETIDGVDHYRRQVESFADAVAADETPPVDRT
ETVDNMAVIDALYESAETGEPAAVDGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaattcggagttctcagtacggcggcgatcggccgcgaagacgtgatcccggcgatc
caggccagcgaacacgccgtcggcgcgatcgcttcacgcgacgccgagcgcgcccggtcg
gtcgccgacgaactcgacatcgatcggtcgtacggcagctacgaggcgctgctggccgac
gaggggatcgacgccgtgtacaacccgctaccgaacagcctccacgcggagtggacacgc
cgcgctgccgatcacggactgcacgtcctctgtgagaagcctctgacgcccgacgccgag
caggcccgcgcgctcttcgactactgcgaccggcagggcgtcactctgatggaggcgttc
atgtaccacttccatcctcgcaccgagcgcgcccgcgagatcgtccgcgaagaactcggc
gaggtgcgccacgtcgaggcgacgttcaccttcgggatgggcgaccgcaccgacgacatc
cggctcgatccggcactggacggcggttcgctcatggacatcggctgctacgccgtcagc
gcggtccggaacgtgctgggcgagccgaaccgcgcgttcgcccacgctgccgacacctac
gataccggcgtcgactcccagctctcgggcctgctgacctacgacgacggcgtgacggcg
cagatcaccagcagcttcgacacgccgatgacccacgagtaccggatcatgacggcggac
ggctggctccacgtccccgaagcattcgacgtggcccccgaccagtcggtgtcgctcacc
tatcaggtcgacggccagcgacacaccgagaccatcgacggcgtcgaccactaccgccgc
caggtcgagagcttcgccgacgccgtcgcggccgacgagacgccgcccgtcgaccggacg
gagacggtcgacaacatggccgtcatcgacgccctctacgagagcgccgagacgggcgag
cccgcagccgtggacggcgagtaa

DBGET integrated database retrieval system