KEGG   Halomonas sp. R57-5: HALO0607Help
Entry
HALO0607          CDS       T04029                                 

Definition
(GenBank) Aminotransferase class-III
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00250  Alanine, aspartate and glutamate metabolism
ham00280  Valine, leucine and isoleucine degradation
ham00410  beta-Alanine metabolism
ham00640  Propanoate metabolism
ham00650  Butanoate metabolism
ham01100  Metabolic pathways
ham01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HALO0607
   00650 Butanoate metabolism
    HALO0607
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HALO0607
   00280 Valine, leucine and isoleucine degradation
    HALO0607
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HALO0607
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ham01007]
    HALO0607
Enzymes [BR:ham01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     HALO0607
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     HALO0607
Amino acid related enzymes [BR:ham01007]
 Aminotransferase (transaminase)
  Class III
   HALO0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CEP34289
UniProt: A0A0D6E4S2
LinkDB All DBs
Position
I:complement(646728..648020)
Genome map
AA seq 430 aa AA seqDB search
MNTDAXPSHSMLRQREQCIPRGVVNAHPIVISHARGSEVFDADGQRYLDFVGGIGVLNVG
HNHPRVVAAVQAQVERISHMSFQVAAYPGYIKLASQLAQLVGGDNAYQSVLFTSGAEAVE
NAIKIARSHTGRPNVIAFRGGFHGRTLLGTTLTGMSQPYRQNFGPFAPAIHHVSYPDALR
GVSSEDVLAELDTLFATEVVPDQVAAILIEPVQGDGGFLPAPVAFMQALRALTERHGIVL
IADEIQTGFGRTGKMFGFEHSNIQPDLVTVAKSLGGGLPISGVVGRTEIMQAPAPGGLGG
TYGGSALSCAAALAVLDIFADEQLLERGIAMGKRLETGLRRLQAKHPVIAEVRGQGPMLA
IELLKGPRVTPEDAALVQQVIDHCREAGLLVIKCGVYRNVIRFLAPLTTSDQQTDEALEI
LDDALSNATH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgatgcccmcccttctcactcaatgctacgccagcgggagcagtgcattccc
cgcggtgtggtcaatgcccatcctattgtcatttcccatgctcgcggtagcgaagtcttc
gacgcggatggccaacgctatctggattttgtcggcgggatcggcgtactcaacgtaggc
cacaatcacccccgcgtcgttgctgcggttcaggcccaagtggaacgtatttcccacatg
agtttccaggtggcggcctacccaggctatataaaactggctagccagctggctcagttg
gtcggtggtgacaacgcctaccaaagcgtgctctttacctccggcgctgaagcagtggaa
aacgccatcaaaattgcccgttcccacacgggacgccccaacgtgattgcctttcgcggt
ggctttcatggacgcacgctgctgggcaccacgctaaccggcatgagccagccctatcgg
caaaactttggcccttttgcccccgctattcaccacgttagctacccggatgcgctgcgg
ggtgttagcagtgaggatgtgcttgccgagctggatacgctgttcgccactgaagtcgtc
cccgaccaggttgccgctatcctgattgagcccgttcagggtgatggcggttttcttcct
gccccagtcgcgtttatgcaggcgcttcgcgctttaaccgaacgccacggcatcgtgctg
atcgccgatgagattcagaccggcttcgggcgcacgggcaagatgtttggctttgaacac
agcaatattcagcctgaccttgtcactgttgctaaaagcctgggcggaggcttgccgatt
tcaggcgtggttgggcgcactgagatcatgcaagctcccgcgccgggtgggctcggcggc
acctatgggggcagcgcgctgagctgcgcggcagcactggcggtgctagatatttttgca
gacgagcaactgcttgagcgtggtatcgccatgggaaaacgcctggaaacagggctgcgt
cggctgcaagccaaacatcctgtgattgccgaggtacgtgggcaaggcccgatgcttgct
atcgagcttctcaagggcccacgggtaacacctgaagacgctgcgctagtgcaacaggtc
attgatcactgtcgtgaagcgggtttgctggtgattaagtgcggtgtataccgcaatgtg
atccgctttctggcaccgctgactaccagcgaccagcaaaccgacgaagcactagagatt
ttggacgacgcgctatccaacgccacgcactaa

DBGET integrated database retrieval system